BLASTX nr result
ID: Mentha25_contig00053589
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00053589 (503 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPE26950.1| hypothetical protein GLAREA_02864 [Glarea lozoyen... 59 5e-07 gb|EHL00733.1| hypothetical protein M7I_3364 [Glarea lozoyensis ... 59 5e-07 gb|ESZ96829.1| hypothetical protein SBOR_2783 [Sclerotinia borea... 56 6e-06 ref|XP_001586780.1| hypothetical protein SS1G_11809 [Sclerotinia... 56 6e-06 ref|XP_001554266.1| hypothetical protein BC1G_06854 [Botryotinia... 56 6e-06 >gb|EPE26950.1| hypothetical protein GLAREA_02864 [Glarea lozoyensis ATCC 20868] Length = 576 Score = 59.3 bits (142), Expect = 5e-07 Identities = 31/45 (68%), Positives = 34/45 (75%), Gaps = 3/45 (6%) Frame = +3 Query: 3 GGGSNYIYRSLDDV-DKNNTAT--GYNAAVAYEDLPRLQKQYQTP 128 GGG ++ YRSLDDV +KNN T YNAAVAYED P LQK YQTP Sbjct: 498 GGGGHHGYRSLDDVGEKNNAGTTPSYNAAVAYEDFPPLQKNYQTP 542 >gb|EHL00733.1| hypothetical protein M7I_3364 [Glarea lozoyensis 74030] Length = 538 Score = 59.3 bits (142), Expect = 5e-07 Identities = 31/45 (68%), Positives = 34/45 (75%), Gaps = 3/45 (6%) Frame = +3 Query: 3 GGGSNYIYRSLDDV-DKNNTAT--GYNAAVAYEDLPRLQKQYQTP 128 GGG ++ YRSLDDV +KNN T YNAAVAYED P LQK YQTP Sbjct: 460 GGGGHHGYRSLDDVGEKNNAGTTPSYNAAVAYEDFPPLQKNYQTP 504 >gb|ESZ96829.1| hypothetical protein SBOR_2783 [Sclerotinia borealis F-4157] Length = 589 Score = 55.8 bits (133), Expect = 6e-06 Identities = 29/45 (64%), Positives = 31/45 (68%), Gaps = 3/45 (6%) Frame = +3 Query: 3 GGGSNYIYRSLDDVDK---NNTATGYNAAVAYEDLPRLQKQYQTP 128 G G Y YRSLDDV++ NNT YN AVAYED P LQK YQTP Sbjct: 503 GKGRGYGYRSLDDVNERSSNNTPPVYNPAVAYEDFPPLQKNYQTP 547 >ref|XP_001586780.1| hypothetical protein SS1G_11809 [Sclerotinia sclerotiorum 1980] gi|154697546|gb|EDN97284.1| hypothetical protein SS1G_11809 [Sclerotinia sclerotiorum 1980 UF-70] Length = 575 Score = 55.8 bits (133), Expect = 6e-06 Identities = 29/45 (64%), Positives = 31/45 (68%), Gaps = 3/45 (6%) Frame = +3 Query: 3 GGGSNYIYRSLDDVDK---NNTATGYNAAVAYEDLPRLQKQYQTP 128 G G Y YRSLDDV++ NNT YN AVAYED P LQK YQTP Sbjct: 499 GKGRGYGYRSLDDVNERSSNNTPPVYNPAVAYEDFPPLQKNYQTP 543 >ref|XP_001554266.1| hypothetical protein BC1G_06854 [Botryotinia fuckeliana B05.10] gi|347836223|emb|CCD50795.1| hypothetical protein BofuT4_P088580.1 [Botryotinia fuckeliana T4] gi|472241986|gb|EMR86690.1| putative tat pathway signal sequence protein [Botryotinia fuckeliana BcDW1] Length = 577 Score = 55.8 bits (133), Expect = 6e-06 Identities = 29/45 (64%), Positives = 31/45 (68%), Gaps = 3/45 (6%) Frame = +3 Query: 3 GGGSNYIYRSLDDVDK---NNTATGYNAAVAYEDLPRLQKQYQTP 128 G G Y YRSLDDV++ NNT YN AVAYED P LQK YQTP Sbjct: 501 GKGRGYGYRSLDDVNERTSNNTPPVYNPAVAYEDFPPLQKNYQTP 545