BLASTX nr result
ID: Mentha25_contig00053558
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00053558 (471 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU45305.1| hypothetical protein MIMGU_mgv1a009570mg [Mimulus... 57 3e-06 >gb|EYU45305.1| hypothetical protein MIMGU_mgv1a009570mg [Mimulus guttatus] Length = 338 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/45 (57%), Positives = 36/45 (80%) Frame = -1 Query: 189 LNVALSLGFLQPGFMITLLSLVNASIKKRSPNCVRTIMSVLLLSS 55 ++ LSLGF +PGF+ITLL LVN SIKKR+P R++++V +LSS Sbjct: 136 IHAVLSLGFFEPGFLITLLFLVNVSIKKRNPRQTRSLVTVFILSS 180