BLASTX nr result
ID: Mentha25_contig00053550
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00053550 (713 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006419168.1| hypothetical protein EUTSA_v10002744mg [Eutr... 57 8e-06 >ref|XP_006419168.1| hypothetical protein EUTSA_v10002744mg [Eutrema salsugineum] gi|557097096|gb|ESQ37604.1| hypothetical protein EUTSA_v10002744mg [Eutrema salsugineum] Length = 90 Score = 56.6 bits (135), Expect = 8e-06 Identities = 27/76 (35%), Positives = 42/76 (55%) Frame = -1 Query: 542 VPVKNVRADWDLPEMTCLYEFPFKVGFRFPLPSLIGQVCGYYNIAPGQLTPNTWRTLIAI 363 +P+ RAD + +YE F G R +PSLIG+V N++P Q +P+ W TLI I Sbjct: 14 IPLPEERADRAGSDEIVIYEAFFSSGLREAVPSLIGEVAALLNVSPSQFSPSMWATLITI 73 Query: 362 EVLAKLVEIPFTYEEV 315 + L +L + +E+ Sbjct: 74 QALRELFSVEIGLDEI 89