BLASTX nr result
ID: Mentha25_contig00053473
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00053473 (422 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPE25722.1| SRF-like protein [Glarea lozoyensis ATCC 20868] 67 3e-09 gb|ESZ91484.1| SRF-type transcription factor [Sclerotinia boreal... 64 2e-08 emb|CCD47903.1| similar to transcription factor MADS [Botryotini... 62 8e-08 gb|EPQ67002.1| Transcription factor [Blumeria graminis f. sp. tr... 61 2e-07 ref|XP_001594158.1| hypothetical protein SS1G_05588 [Sclerotinia... 60 2e-07 emb|CCU83104.1| MADS box transcription factor [Blumeria graminis... 60 3e-07 ref|XP_001222565.1| hypothetical protein CHGG_06470 [Chaetomium ... 60 4e-07 ref|XP_003660102.1| hypothetical protein MYCTH_2132441 [Myceliop... 59 9e-07 emb|CCF35227.1| MADS box protein, partial [Colletotrichum higgin... 57 3e-06 emb|CCF43104.1| SRF-type transcription factor [Colletotrichum hi... 57 3e-06 ref|XP_001907391.1| hypothetical protein [Podospora anserina S m... 57 3e-06 ref|XP_007295208.1| SRF-type transcription factor [Marssonina br... 57 3e-06 gb|ELR04790.1| hypothetical protein, variant [Pseudogymnoascus d... 56 5e-06 ref|XP_006668506.1| MADS box transcription factor Mcm1 [Cordycep... 56 5e-06 gb|EFQ26733.1| SRF-type transcription factor [Colletotrichum gra... 56 5e-06 ref|XP_003052641.1| predicted protein [Nectria haematococca mpVI... 56 5e-06 gb|EQK99495.1| MADS box protein [Ophiocordyceps sinensis CO18] 56 6e-06 gb|EHK44626.1| MADS Box MCM1-like protein [Trichoderma atrovirid... 56 6e-06 ref|XP_964617.1| hypothetical protein NCU07430 [Neurospora crass... 56 6e-06 ref|XP_007275696.1| mads box protein [Colletotrichum gloeosporio... 55 8e-06 >gb|EPE25722.1| SRF-like protein [Glarea lozoyensis ATCC 20868] Length = 210 Score = 67.0 bits (162), Expect = 3e-09 Identities = 29/49 (59%), Positives = 38/49 (77%) Frame = +2 Query: 275 MAEVTEPTDKASSPTLEDHAISNGNQNTTSESRGIKRQRPSTADDDDDD 421 MA++T+ D+ S TL++HA+ NGN ++RGIKRQRPSTADDDDDD Sbjct: 1 MADITDQHDQGSPSTLDEHAVGNGNSLAGGDTRGIKRQRPSTADDDDDD 49 >gb|ESZ91484.1| SRF-type transcription factor [Sclerotinia borealis F-4157] Length = 227 Score = 64.3 bits (155), Expect = 2e-08 Identities = 27/49 (55%), Positives = 38/49 (77%) Frame = +2 Query: 275 MAEVTEPTDKASSPTLEDHAISNGNQNTTSESRGIKRQRPSTADDDDDD 421 MA++T+ D+ S L++HA+ NGN N +++RGIKR RP+TADDDDDD Sbjct: 1 MADITDQHDQNSPSALDEHAVGNGNPNAGTDARGIKRARPTTADDDDDD 49 >emb|CCD47903.1| similar to transcription factor MADS [Botryotinia fuckeliana T4] gi|472246289|gb|EMR90828.1| putative mads box protein [Botryotinia fuckeliana BcDW1] Length = 227 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/49 (55%), Positives = 37/49 (75%) Frame = +2 Query: 275 MAEVTEPTDKASSPTLEDHAISNGNQNTTSESRGIKRQRPSTADDDDDD 421 MA++T+ D+ S L++HA+ NGN S++RGIKR RP+TADDDDDD Sbjct: 1 MADITDQHDQNSPTALDEHAVGNGNPIAGSDARGIKRARPATADDDDDD 49 >gb|EPQ67002.1| Transcription factor [Blumeria graminis f. sp. tritici 96224] Length = 222 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/49 (55%), Positives = 36/49 (73%) Frame = +2 Query: 275 MAEVTEPTDKASSPTLEDHAISNGNQNTTSESRGIKRQRPSTADDDDDD 421 MA++ + D+ S T+++H SNGNQ S+ RG+KRQRPST DDDDDD Sbjct: 1 MADLVDQHDQGSPSTIDEHNPSNGNQAAGSDGRGMKRQRPSTIDDDDDD 49 >ref|XP_001594158.1| hypothetical protein SS1G_05588 [Sclerotinia sclerotiorum 1980] gi|154703370|gb|EDO03109.1| hypothetical protein SS1G_05588 [Sclerotinia sclerotiorum 1980 UF-70] gi|226938411|gb|ACO94162.1| MADS box transcription factor [Sclerotinia sclerotiorum] Length = 226 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/49 (53%), Positives = 37/49 (75%) Frame = +2 Query: 275 MAEVTEPTDKASSPTLEDHAISNGNQNTTSESRGIKRQRPSTADDDDDD 421 MA++T+ D+ S L++HA+ NGN S++RGIKR RP+TA+DDDDD Sbjct: 1 MADITDQHDQNSPSALDEHAVGNGNPIAGSDARGIKRARPATAEDDDDD 49 >emb|CCU83104.1| MADS box transcription factor [Blumeria graminis f. sp. hordei DH14] Length = 222 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/49 (53%), Positives = 36/49 (73%) Frame = +2 Query: 275 MAEVTEPTDKASSPTLEDHAISNGNQNTTSESRGIKRQRPSTADDDDDD 421 MA++ + ++ S T+++H SNGNQ S+ RG+KRQRPST DDDDDD Sbjct: 1 MADLVDQHEQGSPSTIDEHNPSNGNQTAGSDGRGMKRQRPSTIDDDDDD 49 >ref|XP_001222565.1| hypothetical protein CHGG_06470 [Chaetomium globosum CBS 148.51] gi|88182383|gb|EAQ89851.1| hypothetical protein CHGG_06470 [Chaetomium globosum CBS 148.51] Length = 203 Score = 59.7 bits (143), Expect = 4e-07 Identities = 30/50 (60%), Positives = 36/50 (72%), Gaps = 1/50 (2%) Frame = +2 Query: 275 MAEVTEPTDKASSPTLED-HAISNGNQNTTSESRGIKRQRPSTADDDDDD 421 MA++T+ D+ S LED H + NGN N E+RGIKR RPSTADDDDDD Sbjct: 1 MADITDQHDQTSPTELEDAHTVGNGNNNV-GETRGIKRARPSTADDDDDD 49 >ref|XP_003660102.1| hypothetical protein MYCTH_2132441 [Myceliophthora thermophila ATCC 42464] gi|347007369|gb|AEO54857.1| hypothetical protein MYCTH_2132441 [Myceliophthora thermophila ATCC 42464] Length = 219 Score = 58.5 bits (140), Expect = 9e-07 Identities = 29/50 (58%), Positives = 37/50 (74%), Gaps = 1/50 (2%) Frame = +2 Query: 275 MAEVTEPTDKASSPTLED-HAISNGNQNTTSESRGIKRQRPSTADDDDDD 421 MA++T+ ++ S L+D HA+ NGN N E+RGIKR RPSTADDDDDD Sbjct: 1 MADITDQHEQTSPTELDDAHAVGNGNNNV-GETRGIKRARPSTADDDDDD 49 >emb|CCF35227.1| MADS box protein, partial [Colletotrichum higginsianum] Length = 64 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/49 (53%), Positives = 36/49 (73%) Frame = +2 Query: 275 MAEVTEPTDKASSPTLEDHAISNGNQNTTSESRGIKRQRPSTADDDDDD 421 MA++T+ D+ S L++ + NGN +E+RG+KRQRPSTADDDDDD Sbjct: 1 MADITDQHDQTSPTDLDESQVGNGN---AAENRGVKRQRPSTADDDDDD 46 >emb|CCF43104.1| SRF-type transcription factor [Colletotrichum higginsianum] Length = 221 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/49 (53%), Positives = 36/49 (73%) Frame = +2 Query: 275 MAEVTEPTDKASSPTLEDHAISNGNQNTTSESRGIKRQRPSTADDDDDD 421 MA++T+ D+ S L++ + NGN +E+RG+KRQRPSTADDDDDD Sbjct: 1 MADITDQHDQTSPTDLDESQVGNGN---AAENRGVKRQRPSTADDDDDD 46 >ref|XP_001907391.1| hypothetical protein [Podospora anserina S mat+] gi|170942410|emb|CAP68062.1| unnamed protein product [Podospora anserina S mat+] Length = 221 Score = 57.0 bits (136), Expect = 3e-06 Identities = 28/50 (56%), Positives = 37/50 (74%), Gaps = 1/50 (2%) Frame = +2 Query: 275 MAEVTEPTDKASSPTLED-HAISNGNQNTTSESRGIKRQRPSTADDDDDD 421 MA++T+ D+ + L+D H++ NGN + ESRGIKR RPSTADDDDDD Sbjct: 1 MADITDQHDQTTPTELDDAHSVGNGN-SVAGESRGIKRARPSTADDDDDD 49 >ref|XP_007295208.1| SRF-type transcription factor [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] gi|406861544|gb|EKD14598.1| SRF-type transcription factor [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] Length = 345 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/52 (50%), Positives = 35/52 (67%) Frame = +2 Query: 266 LRTMAEVTEPTDKASSPTLEDHAISNGNQNTTSESRGIKRQRPSTADDDDDD 421 + TMA++T+ D+ S L+DHA+ N N E RG+KRQR + ADDDDDD Sbjct: 125 ISTMADITDQHDQGSPSALDDHAVGNSN-----EGRGVKRQRAAAADDDDDD 171 >gb|ELR04790.1| hypothetical protein, variant [Pseudogymnoascus destructans 20631-21] gi|440634872|gb|ELR04791.1| hypothetical protein GMDG_07017 [Pseudogymnoascus destructans 20631-21] Length = 224 Score = 56.2 bits (134), Expect = 5e-06 Identities = 30/51 (58%), Positives = 38/51 (74%), Gaps = 2/51 (3%) Frame = +2 Query: 275 MAEVTEPT-DKASSPTLED-HAISNGNQNTTSESRGIKRQRPSTADDDDDD 421 MA++T+ D+AS LED HA+ NG T ++RG+KRQRPSTADDDDDD Sbjct: 1 MADITDQQPDQASPSVLEDAHAVGNGTA-TAPDNRGVKRQRPSTADDDDDD 50 >ref|XP_006668506.1| MADS box transcription factor Mcm1 [Cordyceps militaris CM01] gi|346325423|gb|EGX95020.1| MADS box transcription factor Mcm1 [Cordyceps militaris CM01] Length = 330 Score = 56.2 bits (134), Expect = 5e-06 Identities = 28/50 (56%), Positives = 37/50 (74%) Frame = +2 Query: 272 TMAEVTEPTDKASSPTLEDHAISNGNQNTTSESRGIKRQRPSTADDDDDD 421 TMA++T+ D+ S ++D A S GN + SESRG+KRQRP+ ADDDDDD Sbjct: 110 TMADITDQHDQTSPHDIDD-ANSVGNGSAPSESRGVKRQRPTPADDDDDD 158 >gb|EFQ26733.1| SRF-type transcription factor [Colletotrichum graminicola M1.001] Length = 222 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/49 (53%), Positives = 35/49 (71%) Frame = +2 Query: 275 MAEVTEPTDKASSPTLEDHAISNGNQNTTSESRGIKRQRPSTADDDDDD 421 MA++T+ D+ S L++ + NGN E+RG+KRQRPSTADDDDDD Sbjct: 1 MADITDQHDQTSPTDLDESQVGNGN---VPENRGVKRQRPSTADDDDDD 46 >ref|XP_003052641.1| predicted protein [Nectria haematococca mpVI 77-13-4] gi|256733581|gb|EEU46928.1| predicted protein [Nectria haematococca mpVI 77-13-4] Length = 224 Score = 56.2 bits (134), Expect = 5e-06 Identities = 28/49 (57%), Positives = 36/49 (73%) Frame = +2 Query: 275 MAEVTEPTDKASSPTLEDHAISNGNQNTTSESRGIKRQRPSTADDDDDD 421 MA++T+ D+ +SPT D + + GN N +ESRGIKRQRPS DDDDDD Sbjct: 1 MADITDQHDQ-TSPTELDESQNVGNGNAATESRGIKRQRPSAGDDDDDD 48 >gb|EQK99495.1| MADS box protein [Ophiocordyceps sinensis CO18] Length = 226 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/49 (55%), Positives = 36/49 (73%) Frame = +2 Query: 275 MAEVTEPTDKASSPTLEDHAISNGNQNTTSESRGIKRQRPSTADDDDDD 421 MA++T+ D+ S L+D ++ GN +ESRGIKRQRP+TADDDDDD Sbjct: 1 MADMTDQHDQTSPTDLDDSHVA-GNGTAAAESRGIKRQRPATADDDDDD 48 >gb|EHK44626.1| MADS Box MCM1-like protein [Trichoderma atroviride IMI 206040] Length = 223 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/50 (52%), Positives = 37/50 (74%), Gaps = 1/50 (2%) Frame = +2 Query: 275 MAEVTEPTDKASSPTLED-HAISNGNQNTTSESRGIKRQRPSTADDDDDD 421 MA++T+ D+ S L+D H++ NGN N +E+RG+KRQRP+ DDDDDD Sbjct: 1 MADITDQHDQTSPADLDDAHSVGNGN-NANNENRGVKRQRPAADDDDDDD 49 >ref|XP_964617.1| hypothetical protein NCU07430 [Neurospora crassa OR74A] gi|28926406|gb|EAA35381.1| MADS box protein [Neurospora crassa OR74A] Length = 224 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/50 (54%), Positives = 37/50 (74%), Gaps = 1/50 (2%) Frame = +2 Query: 275 MAEVTEPTDKASSPTLED-HAISNGNQNTTSESRGIKRQRPSTADDDDDD 421 MA++T+ ++ S L+D HA+ NGN N +E RG+KR RP+TADDDDDD Sbjct: 1 MADITDQHEQTSPTELDDAHAVGNGNVNN-NEPRGVKRARPATADDDDDD 49 >ref|XP_007275696.1| mads box protein [Colletotrichum gloeosporioides Nara gc5] gi|429860482|gb|ELA35218.1| mads box protein [Colletotrichum gloeosporioides Nara gc5] gi|530460156|gb|EQB43548.1| SRF-type transcription factor [Colletotrichum gloeosporioides Cg-14] Length = 197 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/49 (51%), Positives = 36/49 (73%) Frame = +2 Query: 275 MAEVTEPTDKASSPTLEDHAISNGNQNTTSESRGIKRQRPSTADDDDDD 421 MA++T+ D+ S L++ + NGN +E+RG+KRQRPSTADD+DDD Sbjct: 1 MADITDQHDQTSPTDLDESQVGNGN---AAENRGVKRQRPSTADDEDDD 46