BLASTX nr result
ID: Mentha25_contig00053250
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00053250 (462 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPQ66949.1| hypothetical protein BGT96224_Ac30412 [Blumeria g... 59 9e-07 >gb|EPQ66949.1| hypothetical protein BGT96224_Ac30412 [Blumeria graminis f. sp. tritici 96224] Length = 449 Score = 58.5 bits (140), Expect = 9e-07 Identities = 30/57 (52%), Positives = 39/57 (68%) Frame = -1 Query: 453 TPKTSVAENLPLFSHSINTISSPIPGSVQHHPVLFEGTNLSNPNPLNFISLKEARRR 283 +P S + PL SHS++ ISSP+PGSVQHH + +G + N N L ISL+EARRR Sbjct: 323 SPHVSPHDFHPLTSHSLSKISSPLPGSVQHHQISVQGLKMPN-NTLKMISLEEARRR 378