BLASTX nr result
ID: Mentha25_contig00053061
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00053061 (305 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002309067.1| hypothetical protein POPTR_0006s08760g [Popu... 64 2e-08 gb|EYU26601.1| hypothetical protein MIMGU_mgv1a013978mg [Mimulus... 56 6e-06 >ref|XP_002309067.1| hypothetical protein POPTR_0006s08760g [Populus trichocarpa] gi|222855043|gb|EEE92590.1| hypothetical protein POPTR_0006s08760g [Populus trichocarpa] Length = 261 Score = 64.3 bits (155), Expect = 2e-08 Identities = 41/113 (36%), Positives = 60/113 (53%), Gaps = 19/113 (16%) Frame = +3 Query: 18 MEADMINPVEINS----------IACLNKKRKLQDELLVMPSSKHLCWDQRFVCDFPS-- 161 M+ D +P EINS + CLNKKRKLQDE + +P SKH CWD R + + Sbjct: 1 MDEDSGDPSEINSFQFKEAPNSKLFCLNKKRKLQDEQVGLPISKHKCWDHRLPLETSTIY 60 Query: 162 -----DSTIDSKMVSSNIFGRGVE--SEPDFASYSYSFPDKSDLSMSSTGDAK 299 + + + ++ N R ++ S+P+ A S SF SD +MS +G+AK Sbjct: 61 EENQEEKDLITHIIKENAERRAIDEGSDPESAKDSNSFVGDSDSAMSVSGEAK 113 >gb|EYU26601.1| hypothetical protein MIMGU_mgv1a013978mg [Mimulus guttatus] Length = 204 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/44 (59%), Positives = 32/44 (72%) Frame = +3 Query: 36 NPVEINSIACLNKKRKLQDELLVMPSSKHLCWDQRFVCDFPSDS 167 +P EINSI CL+KKRKLQDELL +P KH+CW Q F S++ Sbjct: 6 SPAEINSIDCLSKKRKLQDELLELPLLKHVCWHQNPELVFSSNN 49