BLASTX nr result
ID: Mentha25_contig00053010
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00053010 (451 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU34107.1| hypothetical protein MIMGU_mgv1a0009452mg, partia... 70 4e-10 >gb|EYU34107.1| hypothetical protein MIMGU_mgv1a0009452mg, partial [Mimulus guttatus] Length = 464 Score = 69.7 bits (169), Expect = 4e-10 Identities = 33/67 (49%), Positives = 43/67 (64%), Gaps = 4/67 (5%) Frame = +1 Query: 40 YRKEWPHAVPPW----HQQCSIREAYISRHTTLNQFKYFDPQIFESFLVGKPPHHLLFNK 207 +R+EW + P W +Q S+REAY+ RHT L QFKY DP VGK PH +LF+K Sbjct: 58 FRQEWQNVAPLWPNGSNQSSSMREAYLFRHTALRQFKYVDPLFRHIPTVGKRPHQILFDK 117 Query: 208 NSIILSQ 228 N+I+ SQ Sbjct: 118 NTILFSQ 124