BLASTX nr result
ID: Mentha25_contig00052932
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00052932 (368 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_008992281.1| hypothetical protein Salmi_Mp015 (mitochondr... 78 1e-12 >ref|YP_008992281.1| hypothetical protein Salmi_Mp015 (mitochondrion) [Salvia miltiorrhiza] gi|534292257|gb|AGU16549.1| hypothetical protein Salmi_Mp015 (mitochondrion) [Salvia miltiorrhiza] Length = 106 Score = 77.8 bits (190), Expect = 1e-12 Identities = 39/54 (72%), Positives = 43/54 (79%) Frame = -1 Query: 275 DKKHQFTLVEVKSKEKRKTVSDSGTHRQVERNSYALAKGTGPIDQFILRLENSS 114 ++K + + SKEKRKTVSDSGTH Q RNSYALAKGTGPIDQFILRL NSS Sbjct: 40 ERKELLSGIREGSKEKRKTVSDSGTHEQAGRNSYALAKGTGPIDQFILRLGNSS 93