BLASTX nr result
ID: Mentha25_contig00052669
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00052669 (365 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU39264.1| hypothetical protein MIMGU_mgv1a019789mg, partial... 59 9e-07 >gb|EYU39264.1| hypothetical protein MIMGU_mgv1a019789mg, partial [Mimulus guttatus] Length = 479 Score = 58.5 bits (140), Expect = 9e-07 Identities = 37/74 (50%), Positives = 46/74 (62%), Gaps = 1/74 (1%) Frame = +1 Query: 145 RWLDRAAIATEI-QTRPSSGEDVRRVKLLLKMIPLLSCFLSLSQVVASGSTFFFEEADFI 321 RWLDRAA+ E Q + S E V+ VK LLKM+P+ + FL+ S V A+GSTFF EE+ I Sbjct: 162 RWLDRAAVVLEEKQGQVCSVEQVKGVKFLLKMVPMWTTFLTFSLVTATGSTFFLEESINI 221 Query: 322 APNDANALDAVLLF 363 N VLLF Sbjct: 222 -----NTDSPVLLF 230