BLASTX nr result
ID: Mentha25_contig00051764
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00051764 (338 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAE03590.1| OSJNBa0087O24.13 [Oryza sativa Japonica Group] 57 2e-06 gb|ADB85290.1| putative retrotransposon protein [Phyllostachys e... 56 6e-06 >emb|CAE03590.1| OSJNBa0087O24.13 [Oryza sativa Japonica Group] Length = 1311 Score = 57.4 bits (137), Expect = 2e-06 Identities = 30/70 (42%), Positives = 39/70 (55%), Gaps = 2/70 (2%) Frame = +3 Query: 93 PKYVPD--LPHTDDNGEFIVAPLGILGNRVVQRKDAENFQILVQWLNSDETVATWEDEMH 266 PK VP+ LP TDDNG + P +L R++ + +A Q VQW N + ATWED Sbjct: 1242 PKVVPEPGLPLTDDNGNILSQPTAVLERRLIPQNNAPVVQWKVQWANLPLSAATWEDAAF 1301 Query: 267 IRCKFRSFNP 296 I F +FNP Sbjct: 1302 ISKVFPAFNP 1311 >gb|ADB85290.1| putative retrotransposon protein [Phyllostachys edulis] Length = 592 Score = 55.8 bits (133), Expect = 6e-06 Identities = 22/27 (81%), Positives = 26/27 (96%) Frame = +3 Query: 18 PGLLQPLPIPQNAWTHISLDFVEGLPK 98 PGLLQP+PIP+ AWTHIS+DF+EGLPK Sbjct: 360 PGLLQPIPIPEMAWTHISMDFIEGLPK 386