BLASTX nr result
ID: Mentha25_contig00051627
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00051627 (496 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001937846.1| hypothetical protein PTRG_07514 [Pyrenophora... 72 8e-11 ref|XP_001936310.1| conserved hypothetical protein [Pyrenophora ... 72 8e-11 ref|XP_001935883.1| conserved hypothetical protein [Pyrenophora ... 72 8e-11 ref|XP_001942468.1| predicted protein [Pyrenophora tritici-repen... 72 8e-11 ref|XP_001942128.1| conserved hypothetical protein [Pyrenophora ... 72 8e-11 ref|XP_001933438.1| conserved hypothetical protein [Pyrenophora ... 72 8e-11 ref|XP_001933059.1| conserved hypothetical protein [Pyrenophora ... 72 8e-11 ref|XP_001933025.1| conserved hypothetical protein [Pyrenophora ... 72 8e-11 ref|XP_001932806.1| conserved hypothetical protein [Pyrenophora ... 72 8e-11 ref|XP_001940974.1| conserved hypothetical protein [Pyrenophora ... 72 8e-11 ref|XP_001932325.1| conserved hypothetical protein [Pyrenophora ... 72 8e-11 ref|XP_001932112.1| conserved hypothetical protein [Pyrenophora ... 72 8e-11 ref|XP_001931480.1| conserved hypothetical protein [Pyrenophora ... 72 8e-11 ref|XP_001931466.1| conserved hypothetical protein [Pyrenophora ... 72 8e-11 ref|XP_001937171.1| conserved hypothetical protein [Pyrenophora ... 72 1e-10 ref|XP_003299924.1| hypothetical protein PTT_11032 [Pyrenophora ... 71 2e-10 ref|XP_003306266.1| hypothetical protein PTT_19388 [Pyrenophora ... 71 2e-10 gb|ADO33890.1| polyprotein [Pyrenophora tritici-repentis] 71 2e-10 ref|XP_001934123.1| conserved hypothetical protein [Pyrenophora ... 71 2e-10 ref|XP_001940016.1| conserved hypothetical protein [Pyrenophora ... 71 2e-10 >ref|XP_001937846.1| hypothetical protein PTRG_07514 [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187984945|gb|EDU50433.1| hypothetical protein PTRG_07514 [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 434 Score = 72.0 bits (175), Expect = 8e-11 Identities = 31/48 (64%), Positives = 41/48 (85%) Frame = -3 Query: 494 ELSEIRWINGHDDPADALTKKNPVKDLEKFINTNELTIRVEGWVERGT 351 E++EIRWING D+PADA TK +P + LE+FI+ N+LT+RVEGWV+R T Sbjct: 383 EITEIRWINGEDNPADAFTKASPNRALERFIDGNKLTVRVEGWVQRPT 430 >ref|XP_001936310.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187983409|gb|EDU48897.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 1375 Score = 72.0 bits (175), Expect = 8e-11 Identities = 31/48 (64%), Positives = 41/48 (85%) Frame = -3 Query: 494 ELSEIRWINGHDDPADALTKKNPVKDLEKFINTNELTIRVEGWVERGT 351 E++EIRWING D+PADA TK +P + LE+FI+ N+LT+RVEGWV+R T Sbjct: 1324 EITEIRWINGEDNPADAFTKASPNRALERFIDGNKLTVRVEGWVQRPT 1371 >ref|XP_001935883.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187982982|gb|EDU48470.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 1518 Score = 72.0 bits (175), Expect = 8e-11 Identities = 31/48 (64%), Positives = 41/48 (85%) Frame = -3 Query: 494 ELSEIRWINGHDDPADALTKKNPVKDLEKFINTNELTIRVEGWVERGT 351 E++EIRWING D+PADA TK +P + LE+FI+ N+LT+RVEGWV+R T Sbjct: 1467 EITEIRWINGEDNPADAFTKASPNRALERFIDGNKLTVRVEGWVQRPT 1514 >ref|XP_001942468.1| predicted protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187980704|gb|EDU47330.1| predicted protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 201 Score = 72.0 bits (175), Expect = 8e-11 Identities = 31/48 (64%), Positives = 41/48 (85%) Frame = -3 Query: 494 ELSEIRWINGHDDPADALTKKNPVKDLEKFINTNELTIRVEGWVERGT 351 E++EIRWING D+PADA TK +P + LE+FI+ N+LT+RVEGWV+R T Sbjct: 150 EITEIRWINGEDNPADAFTKASPNRALERFIDGNKLTVRVEGWVQRPT 197 >ref|XP_001942128.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187979327|gb|EDU45953.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 1504 Score = 72.0 bits (175), Expect = 8e-11 Identities = 31/48 (64%), Positives = 41/48 (85%) Frame = -3 Query: 494 ELSEIRWINGHDDPADALTKKNPVKDLEKFINTNELTIRVEGWVERGT 351 E++EIRWING D+PADA TK +P + LE+FI+ N+LT+RVEGWV+R T Sbjct: 1453 EITEIRWINGEDNPADAFTKASPNRALERFIDGNKLTVRVEGWVQRPT 1500 >ref|XP_001933438.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187979002|gb|EDU45628.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 1426 Score = 72.0 bits (175), Expect = 8e-11 Identities = 31/48 (64%), Positives = 41/48 (85%) Frame = -3 Query: 494 ELSEIRWINGHDDPADALTKKNPVKDLEKFINTNELTIRVEGWVERGT 351 E++EIRWING D+PADA TK +P + LE+FI+ N+LT+RVEGWV+R T Sbjct: 1375 EITEIRWINGEDNPADAFTKASPNRALERFIDGNKLTVRVEGWVQRPT 1422 >ref|XP_001933059.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187978623|gb|EDU45249.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 1442 Score = 72.0 bits (175), Expect = 8e-11 Identities = 31/48 (64%), Positives = 41/48 (85%) Frame = -3 Query: 494 ELSEIRWINGHDDPADALTKKNPVKDLEKFINTNELTIRVEGWVERGT 351 E++EIRWING D+PADA TK +P + LE+FI+ N+LT+RVEGWV+R T Sbjct: 1391 EITEIRWINGEDNPADAFTKASPNRALERFIDGNKLTVRVEGWVQRPT 1438 >ref|XP_001933025.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187978589|gb|EDU45215.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 1426 Score = 72.0 bits (175), Expect = 8e-11 Identities = 31/48 (64%), Positives = 41/48 (85%) Frame = -3 Query: 494 ELSEIRWINGHDDPADALTKKNPVKDLEKFINTNELTIRVEGWVERGT 351 E++EIRWING D+PADA TK +P + LE+FI+ N+LT+RVEGWV+R T Sbjct: 1375 EITEIRWINGEDNPADAFTKASPNRALERFIDGNKLTVRVEGWVQRPT 1422 >ref|XP_001932806.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187978370|gb|EDU44996.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 902 Score = 72.0 bits (175), Expect = 8e-11 Identities = 31/48 (64%), Positives = 41/48 (85%) Frame = -3 Query: 494 ELSEIRWINGHDDPADALTKKNPVKDLEKFINTNELTIRVEGWVERGT 351 E++EIRWING D+PADA TK +P + LE+FI+ N+LT+RVEGWV+R T Sbjct: 851 EITEIRWINGEDNPADAFTKASPNRALERFIDGNKLTVRVEGWVQRPT 898 >ref|XP_001940974.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187977067|gb|EDU43693.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 1464 Score = 72.0 bits (175), Expect = 8e-11 Identities = 31/48 (64%), Positives = 41/48 (85%) Frame = -3 Query: 494 ELSEIRWINGHDDPADALTKKNPVKDLEKFINTNELTIRVEGWVERGT 351 E++EIRWING D+PADA TK +P + LE+FI+ N+LT+RVEGWV+R T Sbjct: 1413 EITEIRWINGEDNPADAFTKASPNRALERFIDGNKLTVRVEGWVQRPT 1460 >ref|XP_001932325.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187973931|gb|EDU41430.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 1519 Score = 72.0 bits (175), Expect = 8e-11 Identities = 31/48 (64%), Positives = 41/48 (85%) Frame = -3 Query: 494 ELSEIRWINGHDDPADALTKKNPVKDLEKFINTNELTIRVEGWVERGT 351 E++EIRWING D+PADA TK +P + LE+FI+ N+LT+RVEGWV+R T Sbjct: 1468 EITEIRWINGEDNPADAFTKASPNRALERFIDGNKLTVRVEGWVQRPT 1515 >ref|XP_001932112.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187973718|gb|EDU41217.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 842 Score = 72.0 bits (175), Expect = 8e-11 Identities = 31/48 (64%), Positives = 41/48 (85%) Frame = -3 Query: 494 ELSEIRWINGHDDPADALTKKNPVKDLEKFINTNELTIRVEGWVERGT 351 E++EIRWING D+PADA TK +P + LE+FI+ N+LT+RVEGWV+R T Sbjct: 791 EITEIRWINGEDNPADAFTKASPNRALERFIDGNKLTVRVEGWVQRPT 838 >ref|XP_001931480.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187973086|gb|EDU40585.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 1221 Score = 72.0 bits (175), Expect = 8e-11 Identities = 31/48 (64%), Positives = 41/48 (85%) Frame = -3 Query: 494 ELSEIRWINGHDDPADALTKKNPVKDLEKFINTNELTIRVEGWVERGT 351 E++EIRWING D+PADA TK +P + LE+FI+ N+LT+RVEGWV+R T Sbjct: 1170 EITEIRWINGEDNPADAFTKASPNRALERFIDGNKLTVRVEGWVQRPT 1217 >ref|XP_001931466.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187973072|gb|EDU40571.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 752 Score = 72.0 bits (175), Expect = 8e-11 Identities = 31/48 (64%), Positives = 41/48 (85%) Frame = -3 Query: 494 ELSEIRWINGHDDPADALTKKNPVKDLEKFINTNELTIRVEGWVERGT 351 E++EIRWING D+PADA TK +P + LE+FI+ N+LT+RVEGWV+R T Sbjct: 701 EITEIRWINGEDNPADAFTKASPNRALERFIDGNKLTVRVEGWVQRPT 748 >ref|XP_001937171.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187984270|gb|EDU49758.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 1516 Score = 71.6 bits (174), Expect = 1e-10 Identities = 31/48 (64%), Positives = 40/48 (83%) Frame = -3 Query: 494 ELSEIRWINGHDDPADALTKKNPVKDLEKFINTNELTIRVEGWVERGT 351 E++EIRWING D+PADA TK +P + LE+FI+ NELT RV+GWV+R T Sbjct: 1465 EITEIRWINGEDNPADAFTKASPNRALERFIDNNELTARVDGWVQRPT 1512 >ref|XP_003299924.1| hypothetical protein PTT_11032 [Pyrenophora teres f. teres 0-1] gi|311326186|gb|EFQ91980.1| hypothetical protein PTT_11032 [Pyrenophora teres f. teres 0-1] Length = 182 Score = 70.9 bits (172), Expect = 2e-10 Identities = 30/48 (62%), Positives = 41/48 (85%) Frame = -3 Query: 494 ELSEIRWINGHDDPADALTKKNPVKDLEKFINTNELTIRVEGWVERGT 351 E++EIRWING D+PADA TK +P + LE+FI+ N+LT+RV+GWV+R T Sbjct: 131 EITEIRWINGEDNPADAFTKASPNRALERFIDGNKLTVRVDGWVQRPT 178 >ref|XP_003306266.1| hypothetical protein PTT_19388 [Pyrenophora teres f. teres 0-1] gi|311316271|gb|EFQ85638.1| hypothetical protein PTT_19388 [Pyrenophora teres f. teres 0-1] Length = 533 Score = 70.9 bits (172), Expect = 2e-10 Identities = 30/48 (62%), Positives = 41/48 (85%) Frame = -3 Query: 494 ELSEIRWINGHDDPADALTKKNPVKDLEKFINTNELTIRVEGWVERGT 351 E++EIRWING D+PADA TK +P + LE+FI+ N+LT+RV+GWV+R T Sbjct: 482 EITEIRWINGEDNPADAFTKASPNRALERFIDGNKLTVRVDGWVQRPT 529 >gb|ADO33890.1| polyprotein [Pyrenophora tritici-repentis] Length = 1730 Score = 70.9 bits (172), Expect = 2e-10 Identities = 30/48 (62%), Positives = 41/48 (85%) Frame = -3 Query: 494 ELSEIRWINGHDDPADALTKKNPVKDLEKFINTNELTIRVEGWVERGT 351 E++EIRWING D+PADA TK +P + LE+FI+ N+LT+RV+GWV+R T Sbjct: 1679 EITEIRWINGEDNPADAFTKASPNRALERFIDGNKLTVRVDGWVQRPT 1726 >ref|XP_001934123.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187980002|gb|EDU46628.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 1697 Score = 70.9 bits (172), Expect = 2e-10 Identities = 30/48 (62%), Positives = 41/48 (85%) Frame = -3 Query: 494 ELSEIRWINGHDDPADALTKKNPVKDLEKFINTNELTIRVEGWVERGT 351 E++EIRWING D+PADA TK +P + LE+FI+ N+LT+RV+GWV+R T Sbjct: 1646 EITEIRWINGEDNPADAFTKASPNRALERFIDGNKLTVRVDGWVQRPT 1693 >ref|XP_001940016.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187976109|gb|EDU42735.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 1730 Score = 70.9 bits (172), Expect = 2e-10 Identities = 30/48 (62%), Positives = 41/48 (85%) Frame = -3 Query: 494 ELSEIRWINGHDDPADALTKKNPVKDLEKFINTNELTIRVEGWVERGT 351 E++EIRWING D+PADA TK +P + LE+FI+ N+LT+RV+GWV+R T Sbjct: 1679 EITEIRWINGEDNPADAFTKASPNRALERFIDGNKLTVRVDGWVQRPT 1726