BLASTX nr result
ID: Mentha25_contig00051588
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00051588 (501 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS72207.1| hypothetical protein M569_02539, partial [Genlise... 60 4e-07 gb|EYU32396.1| hypothetical protein MIMGU_mgv1a024191mg [Mimulus... 59 5e-07 >gb|EPS72207.1| hypothetical protein M569_02539, partial [Genlisea aurea] Length = 1763 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/41 (65%), Positives = 34/41 (82%) Frame = -1 Query: 432 IKASFRAIRSIDDLPTFQMPDAKERKAADILEWLSLCFGFK 310 IKA+ RAIR++D+LP F+MP+ K R A DILEWLSL FGF+ Sbjct: 69 IKAALRAIRNVDNLPPFEMPEGKTRTANDILEWLSLRFGFQ 109 >gb|EYU32396.1| hypothetical protein MIMGU_mgv1a024191mg [Mimulus guttatus] Length = 1907 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/41 (63%), Positives = 34/41 (82%) Frame = -1 Query: 432 IKASFRAIRSIDDLPTFQMPDAKERKAADILEWLSLCFGFK 310 IKA+ RAIR++++LP FQMP+ KER DILEWL+L FGF+ Sbjct: 207 IKAALRAIRNVENLPVFQMPEGKERTVNDILEWLALRFGFQ 247