BLASTX nr result
ID: Mentha25_contig00051543
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00051543 (567 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU22706.1| hypothetical protein MIMGU_mgv1a016806mg [Mimulus... 112 3e-26 gb|EYU22707.1| hypothetical protein MIMGU_mgv1a016806mg [Mimulus... 112 1e-25 sp|Q04189.1|TAP1_ANTMA RecName: Full=Protein TAP1; Flags: Precur... 102 1e-24 gb|EYU22705.1| hypothetical protein MIMGU_mgv1a020969mg [Mimulus... 79 8e-13 gb|EPS60782.1| hypothetical protein M569_14020, partial [Genlise... 77 3e-12 ref|XP_002310592.2| pentatricopeptide repeat-containing family p... 75 9e-12 ref|XP_006643820.1| PREDICTED: pentatricopeptide repeat-containi... 74 2e-11 ref|XP_006390774.1| hypothetical protein EUTSA_v10018183mg [Eutr... 74 2e-11 ref|XP_006301205.1| hypothetical protein CARUB_v10021604mg [Caps... 74 2e-11 ref|XP_004292402.1| PREDICTED: pentatricopeptide repeat-containi... 74 2e-11 ref|XP_004247664.1| PREDICTED: pentatricopeptide repeat-containi... 74 3e-11 ref|XP_004494044.1| PREDICTED: putative pentatricopeptide repeat... 74 3e-11 gb|EXB44215.1| hypothetical protein L484_002907 [Morus notabilis] 73 5e-11 ref|NP_001078212.1| pentatricopeptide repeat-containing protein ... 73 5e-11 ref|NP_177298.1| pentatricopeptide repeat-containing protein [Ar... 73 5e-11 ref|XP_002888836.1| pentatricopeptide repeat-containing protein ... 73 5e-11 gb|EAY72751.1| hypothetical protein OsI_00617 [Oryza sativa Indi... 73 5e-11 dbj|BAF00431.1| hypothetical protein [Arabidopsis thaliana] 73 5e-11 ref|NP_001042180.1| Os01g0176300 [Oryza sativa Japonica Group] g... 73 5e-11 ref|XP_006412272.1| hypothetical protein EUTSA_v10027054mg [Eutr... 73 6e-11 >gb|EYU22706.1| hypothetical protein MIMGU_mgv1a016806mg [Mimulus guttatus] Length = 106 Score = 112 bits (280), Expect(2) = 3e-26 Identities = 45/50 (90%), Positives = 49/50 (98%) Frame = +3 Query: 3 DHCLKECKASGIGVAVCIKYCPVHCLPPDTSTKEHYCSLGCMLDQCAKFT 152 DHCLKECK+SG+GVAVC+KYCPVHCLPPD STKEHYC+LGCMLDQCAKFT Sbjct: 35 DHCLKECKSSGVGVAVCVKYCPVHCLPPDASTKEHYCNLGCMLDQCAKFT 84 Score = 32.3 bits (72), Expect(2) = 3e-26 Identities = 12/17 (70%), Positives = 15/17 (88%) Frame = +2 Query: 236 ADEKKMTDCVFKCRKFH 286 +DEKKM DCV KCRK++ Sbjct: 85 SDEKKMNDCVSKCRKYN 101 >gb|EYU22707.1| hypothetical protein MIMGU_mgv1a016806mg [Mimulus guttatus] Length = 105 Score = 112 bits (280), Expect(2) = 1e-25 Identities = 45/50 (90%), Positives = 49/50 (98%) Frame = +3 Query: 3 DHCLKECKASGIGVAVCIKYCPVHCLPPDTSTKEHYCSLGCMLDQCAKFT 152 DHCLKECK+SG+GVAVC+KYCPVHCLPPD STKEHYC+LGCMLDQCAKFT Sbjct: 35 DHCLKECKSSGVGVAVCVKYCPVHCLPPDASTKEHYCNLGCMLDQCAKFT 84 Score = 30.0 bits (66), Expect(2) = 1e-25 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = +2 Query: 239 DEKKMTDCVFKCRKFH 286 +EKKM DCV KCRK++ Sbjct: 85 NEKKMNDCVSKCRKYN 100 >sp|Q04189.1|TAP1_ANTMA RecName: Full=Protein TAP1; Flags: Precursor gi|16067|emb|CAA40552.1| TAP1 [Antirrhinum majus] Length = 107 Score = 102 bits (254), Expect(2) = 1e-24 Identities = 40/49 (81%), Positives = 46/49 (93%) Frame = +3 Query: 3 DHCLKECKASGIGVAVCIKYCPVHCLPPDTSTKEHYCSLGCMLDQCAKF 149 DHC+KECK SGIGV CIKYCPVHCLPPD+S+KEH+C+LGCMLD+CAKF Sbjct: 35 DHCMKECKLSGIGVVACIKYCPVHCLPPDSSSKEHFCNLGCMLDKCAKF 83 Score = 37.0 bits (84), Expect(2) = 1e-24 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = +2 Query: 239 DEKKMTDCVFKCRKFH 286 DEKKM+DCVF CRKFH Sbjct: 86 DEKKMSDCVFDCRKFH 101 >gb|EYU22705.1| hypothetical protein MIMGU_mgv1a020969mg [Mimulus guttatus] Length = 663 Score = 79.0 bits (193), Expect = 8e-13 Identities = 30/41 (73%), Positives = 36/41 (87%) Frame = -3 Query: 565 CLDCHNLMKLASKLVDKAIIVRDAQRFHHFREGACSCKDYW 443 CLDCHN M+LASKLV+K I+VRD+ RFHHF++G CSC DYW Sbjct: 623 CLDCHNFMRLASKLVEKVIVVRDSNRFHHFKDGVCSCNDYW 663 >gb|EPS60782.1| hypothetical protein M569_14020, partial [Genlisea aurea] Length = 774 Score = 77.0 bits (188), Expect = 3e-12 Identities = 30/41 (73%), Positives = 34/41 (82%) Frame = -3 Query: 565 CLDCHNLMKLASKLVDKAIIVRDAQRFHHFREGACSCKDYW 443 CLDCHN K SK+ ++AIIVRDA RFHHFR GACSC+DYW Sbjct: 734 CLDCHNFTKFVSKITERAIIVRDANRFHHFRNGACSCRDYW 774 >ref|XP_002310592.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|550334248|gb|EEE91042.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 785 Score = 75.5 bits (184), Expect = 9e-12 Identities = 30/41 (73%), Positives = 35/41 (85%) Frame = -3 Query: 565 CLDCHNLMKLASKLVDKAIIVRDAQRFHHFREGACSCKDYW 443 C DCHN +K SKLVD+ IIVRDA RFHHF++G+CSCKDYW Sbjct: 745 CNDCHNAIKFISKLVDREIIVRDATRFHHFKDGSCSCKDYW 785 >ref|XP_006643820.1| PREDICTED: pentatricopeptide repeat-containing protein At2g29760, chloroplastic-like [Oryza brachyantha] Length = 659 Score = 74.3 bits (181), Expect = 2e-11 Identities = 29/41 (70%), Positives = 34/41 (82%) Frame = -3 Query: 565 CLDCHNLMKLASKLVDKAIIVRDAQRFHHFREGACSCKDYW 443 CLDCHN +KL SKL ++ +IVRD RFHHFR G+CSCKDYW Sbjct: 619 CLDCHNAIKLLSKLYEREVIVRDRTRFHHFRHGSCSCKDYW 659 >ref|XP_006390774.1| hypothetical protein EUTSA_v10018183mg [Eutrema salsugineum] gi|557087208|gb|ESQ28060.1| hypothetical protein EUTSA_v10018183mg [Eutrema salsugineum] Length = 747 Score = 74.3 bits (181), Expect = 2e-11 Identities = 28/41 (68%), Positives = 35/41 (85%) Frame = -3 Query: 565 CLDCHNLMKLASKLVDKAIIVRDAQRFHHFREGACSCKDYW 443 C+DCHN MKLASKL+ K I+VRD+ RFHHF++ +CSC DYW Sbjct: 707 CIDCHNFMKLASKLLGKEILVRDSNRFHHFKDSSCSCNDYW 747 >ref|XP_006301205.1| hypothetical protein CARUB_v10021604mg [Capsella rubella] gi|482569915|gb|EOA34103.1| hypothetical protein CARUB_v10021604mg [Capsella rubella] Length = 744 Score = 74.3 bits (181), Expect = 2e-11 Identities = 28/41 (68%), Positives = 35/41 (85%) Frame = -3 Query: 565 CLDCHNLMKLASKLVDKAIIVRDAQRFHHFREGACSCKDYW 443 C+DCHN MKLASKL+ K I++RD+ RFHHF++ ACSC DYW Sbjct: 704 CIDCHNFMKLASKLLGKEILLRDSNRFHHFKDSACSCNDYW 744 >ref|XP_004292402.1| PREDICTED: pentatricopeptide repeat-containing protein At1g71420-like [Fragaria vesca subsp. vesca] Length = 792 Score = 74.3 bits (181), Expect = 2e-11 Identities = 28/41 (68%), Positives = 35/41 (85%) Frame = -3 Query: 565 CLDCHNLMKLASKLVDKAIIVRDAQRFHHFREGACSCKDYW 443 C+DCHN MKLAS L+ K I++RD+ RFHHF++G CSCKDYW Sbjct: 752 CVDCHNFMKLASDLLQKDIVLRDSNRFHHFKDGICSCKDYW 792 >ref|XP_004247664.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14820-like [Solanum lycopersicum] Length = 722 Score = 73.9 bits (180), Expect = 3e-11 Identities = 28/41 (68%), Positives = 35/41 (85%) Frame = -3 Query: 565 CLDCHNLMKLASKLVDKAIIVRDAQRFHHFREGACSCKDYW 443 C DCHN MKLASK+ ++ I+VRD RFHH+R+G+CSCKDYW Sbjct: 682 CEDCHNFMKLASKVFEREIVVRDRTRFHHYRDGSCSCKDYW 722 >ref|XP_004494044.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g11460-like [Cicer arietinum] Length = 641 Score = 73.6 bits (179), Expect = 3e-11 Identities = 29/41 (70%), Positives = 33/41 (80%) Frame = -3 Query: 565 CLDCHNLMKLASKLVDKAIIVRDAQRFHHFREGACSCKDYW 443 C+DCH +KL SK+VD+ IVRDA RFHHFR G CSCKDYW Sbjct: 601 CVDCHVFIKLVSKIVDRQFIVRDATRFHHFRNGVCSCKDYW 641 >gb|EXB44215.1| hypothetical protein L484_002907 [Morus notabilis] Length = 741 Score = 73.2 bits (178), Expect = 5e-11 Identities = 28/41 (68%), Positives = 33/41 (80%) Frame = -3 Query: 565 CLDCHNLMKLASKLVDKAIIVRDAQRFHHFREGACSCKDYW 443 C+DCHN MKLAS L+ K I+VRD+ RFHHF +G CSC DYW Sbjct: 701 CVDCHNFMKLASDLLQKEIVVRDSNRFHHFNDGICSCNDYW 741 >ref|NP_001078212.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75274431|sp|Q9LW32.1|PP258_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At3g26782, mitochondrial; Flags: Precursor gi|9279668|dbj|BAB01225.1| selenium-binding protein-like [Arabidopsis thaliana] gi|332643694|gb|AEE77215.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 659 Score = 73.2 bits (178), Expect = 5e-11 Identities = 27/41 (65%), Positives = 35/41 (85%) Frame = -3 Query: 565 CLDCHNLMKLASKLVDKAIIVRDAQRFHHFREGACSCKDYW 443 C DCHN++KL SK+VD+ +VRDA+RFHHF++G CSC DYW Sbjct: 619 CSDCHNVIKLISKIVDREFVVRDAKRFHHFKDGGCSCGDYW 659 >ref|NP_177298.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75169716|sp|Q9C9H9.1|PP114_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At1g71420 gi|12323734|gb|AAG51830.1|AC016163_19 hypothetical protein; 56014-58251 [Arabidopsis thaliana] gi|332197078|gb|AEE35199.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 745 Score = 73.2 bits (178), Expect = 5e-11 Identities = 27/41 (65%), Positives = 35/41 (85%) Frame = -3 Query: 565 CLDCHNLMKLASKLVDKAIIVRDAQRFHHFREGACSCKDYW 443 C+DCHN MKLASKL+ K I++RD+ RFHHF++ +CSC DYW Sbjct: 705 CIDCHNFMKLASKLLGKEILMRDSNRFHHFKDSSCSCNDYW 745 >ref|XP_002888836.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297334677|gb|EFH65095.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 744 Score = 73.2 bits (178), Expect = 5e-11 Identities = 27/41 (65%), Positives = 35/41 (85%) Frame = -3 Query: 565 CLDCHNLMKLASKLVDKAIIVRDAQRFHHFREGACSCKDYW 443 C+DCHN MKLASKL+ K I++RD+ RFHHF++ +CSC DYW Sbjct: 704 CIDCHNFMKLASKLLGKEILLRDSNRFHHFKDSSCSCNDYW 744 >gb|EAY72751.1| hypothetical protein OsI_00617 [Oryza sativa Indica Group] Length = 425 Score = 73.2 bits (178), Expect = 5e-11 Identities = 29/41 (70%), Positives = 33/41 (80%) Frame = -3 Query: 565 CLDCHNLMKLASKLVDKAIIVRDAQRFHHFREGACSCKDYW 443 CLDCHN +KL SKL + +IVRD RFHHFR G+CSCKDYW Sbjct: 385 CLDCHNAIKLISKLYGREVIVRDRTRFHHFRHGSCSCKDYW 425 >dbj|BAF00431.1| hypothetical protein [Arabidopsis thaliana] Length = 659 Score = 73.2 bits (178), Expect = 5e-11 Identities = 27/41 (65%), Positives = 35/41 (85%) Frame = -3 Query: 565 CLDCHNLMKLASKLVDKAIIVRDAQRFHHFREGACSCKDYW 443 C DCHN++KL SK+VD+ +VRDA+RFHHF++G CSC DYW Sbjct: 619 CSDCHNVIKLISKIVDREFVVRDAKRFHHFKDGGCSCGDYW 659 >ref|NP_001042180.1| Os01g0176300 [Oryza sativa Japonica Group] gi|11034538|dbj|BAB17062.1| hypothetical protein [Oryza sativa Japonica Group] gi|113531711|dbj|BAF04094.1| Os01g0176300 [Oryza sativa Japonica Group] gi|125569234|gb|EAZ10749.1| hypothetical protein OsJ_00586 [Oryza sativa Japonica Group] Length = 665 Score = 73.2 bits (178), Expect = 5e-11 Identities = 29/41 (70%), Positives = 33/41 (80%) Frame = -3 Query: 565 CLDCHNLMKLASKLVDKAIIVRDAQRFHHFREGACSCKDYW 443 CLDCHN +KL SKL + +IVRD RFHHFR G+CSCKDYW Sbjct: 625 CLDCHNAIKLISKLYGREVIVRDRTRFHHFRHGSCSCKDYW 665 >ref|XP_006412272.1| hypothetical protein EUTSA_v10027054mg [Eutrema salsugineum] gi|557113442|gb|ESQ53725.1| hypothetical protein EUTSA_v10027054mg [Eutrema salsugineum] Length = 638 Score = 72.8 bits (177), Expect = 6e-11 Identities = 28/41 (68%), Positives = 36/41 (87%) Frame = -3 Query: 565 CLDCHNLMKLASKLVDKAIIVRDAQRFHHFREGACSCKDYW 443 C DCH+ +KLASK+V++ IIVRD RFHHFR+G+CSC+DYW Sbjct: 598 CGDCHSAIKLASKVVEREIIVRDTNRFHHFRDGSCSCRDYW 638