BLASTX nr result
ID: Mentha25_contig00051440
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00051440 (497 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCU78301.1| bZIP transcription factor (AtfA) [Blumeria grami... 77 2e-12 gb|EPQ64524.1| Basic leucine zipper transcription factor of the ... 76 5e-12 >emb|CCU78301.1| bZIP transcription factor (AtfA) [Blumeria graminis f. sp. hordei DH14] Length = 534 Score = 77.4 bits (189), Expect = 2e-12 Identities = 33/46 (71%), Positives = 40/46 (86%) Frame = -2 Query: 496 MNMHQLMNEGGFTTPINPYNLSAPINHQQPQQHVINGQTMQQRRYS 359 MNMHQL+NEGGFT P+NPY++ AP++HQQ Q VINGQ+M QRRYS Sbjct: 489 MNMHQLINEGGFTAPMNPYSIGAPLSHQQQQPSVINGQSMPQRRYS 534 >gb|EPQ64524.1| Basic leucine zipper transcription factor of the ATF-CREB family [Blumeria graminis f. sp. tritici 96224] Length = 534 Score = 75.9 bits (185), Expect = 5e-12 Identities = 32/46 (69%), Positives = 40/46 (86%) Frame = -2 Query: 496 MNMHQLMNEGGFTTPINPYNLSAPINHQQPQQHVINGQTMQQRRYS 359 MNMHQL+NEGGFT P+NPY++ AP++HQQ Q VINGQ+M QRR+S Sbjct: 489 MNMHQLINEGGFTAPMNPYSIGAPLSHQQQQPSVINGQSMPQRRFS 534