BLASTX nr result
ID: Mentha25_contig00051269
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00051269 (323 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007219034.1| hypothetical protein PRUPE_ppa004557mg [Prun... 60 4e-07 ref|XP_004512775.1| PREDICTED: pentatricopeptide repeat-containi... 59 9e-07 ref|XP_003534128.1| PREDICTED: pentatricopeptide repeat-containi... 58 2e-06 ref|XP_007152653.1| hypothetical protein PHAVU_004G147700g [Phas... 57 2e-06 ref|XP_004306649.1| PREDICTED: pentatricopeptide repeat-containi... 57 2e-06 ref|XP_002515072.1| pentatricopeptide repeat-containing protein,... 57 3e-06 ref|XP_003614316.1| Pentatricopeptide repeat-containing protein ... 57 4e-06 ref|XP_007041542.1| Tetratricopeptide repeat (TPR)-like superfam... 56 5e-06 ref|XP_003619886.1| Pentatricopeptide repeat-containing protein ... 56 5e-06 >ref|XP_007219034.1| hypothetical protein PRUPE_ppa004557mg [Prunus persica] gi|462415496|gb|EMJ20233.1| hypothetical protein PRUPE_ppa004557mg [Prunus persica] Length = 503 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = +3 Query: 225 MSVRWPRLLTPTHLSQLIRMQKNPLKALDIFYE 323 MS+RWPRLLTPTHLSQ+IR QKNPL AL IF E Sbjct: 1 MSIRWPRLLTPTHLSQIIRKQKNPLTALQIFSE 33 >ref|XP_004512775.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05600-like [Cicer arietinum] Length = 502 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = +3 Query: 225 MSVRWPRLLTPTHLSQLIRMQKNPLKALDIFYE 323 MS+RWPR+LTPT+LSQ+IR QKNPLKAL IF E Sbjct: 1 MSIRWPRVLTPTYLSQIIRTQKNPLKALQIFNE 33 >ref|XP_003534128.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05600-like [Glycine max] Length = 502 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/33 (75%), Positives = 31/33 (93%) Frame = +3 Query: 225 MSVRWPRLLTPTHLSQLIRMQKNPLKALDIFYE 323 MS+RWPR+LTPT+LSQ+I+ QKNPLKAL+IF E Sbjct: 1 MSIRWPRVLTPTYLSQIIKTQKNPLKALNIFNE 33 >ref|XP_007152653.1| hypothetical protein PHAVU_004G147700g [Phaseolus vulgaris] gi|561025962|gb|ESW24647.1| hypothetical protein PHAVU_004G147700g [Phaseolus vulgaris] Length = 502 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = +3 Query: 225 MSVRWPRLLTPTHLSQLIRMQKNPLKALDIFYE 323 MS+RWPR+LTPT+LSQ+IR QKNP+KAL IF E Sbjct: 1 MSIRWPRVLTPTYLSQIIRTQKNPIKALHIFNE 33 >ref|XP_004306649.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05600-like [Fragaria vesca subsp. vesca] Length = 506 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = +3 Query: 225 MSVRWPRLLTPTHLSQLIRMQKNPLKALDIFYE 323 MS+RWPRLL+PT+LSQ+IRMQKNPL AL IF E Sbjct: 1 MSIRWPRLLSPTNLSQIIRMQKNPLTALKIFSE 33 >ref|XP_002515072.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223545552|gb|EEF47056.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 504 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = +3 Query: 225 MSVRWPRLLTPTHLSQLIRMQKNPLKALDIFYE 323 M+VRWPRLLTPTHLSQ+IR QKNPL AL IF E Sbjct: 1 MTVRWPRLLTPTHLSQIIRNQKNPLIALRIFKE 33 >ref|XP_003614316.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355515651|gb|AES97274.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 504 Score = 56.6 bits (135), Expect = 4e-06 Identities = 24/34 (70%), Positives = 31/34 (91%) Frame = +3 Query: 222 TMSVRWPRLLTPTHLSQLIRMQKNPLKALDIFYE 323 +MS+RWPR+L PT+L+Q+IR QKNPLKAL+IF E Sbjct: 2 SMSIRWPRVLNPTYLTQIIRTQKNPLKALEIFNE 35 >ref|XP_007041542.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma cacao] gi|508705477|gb|EOX97373.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma cacao] Length = 500 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = +3 Query: 225 MSVRWPRLLTPTHLSQLIRMQKNPLKALDIF 317 MS+RWPR+LTPTHL+Q+IR QKNPL AL IF Sbjct: 1 MSIRWPRVLTPTHLAQIIRTQKNPLTALQIF 31 >ref|XP_003619886.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355494901|gb|AES76104.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 576 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/33 (72%), Positives = 30/33 (90%) Frame = +3 Query: 225 MSVRWPRLLTPTHLSQLIRMQKNPLKALDIFYE 323 MS+RWPR+L PT+L+Q+IR QKNPLKAL+IF E Sbjct: 1 MSIRWPRVLNPTYLTQIIRTQKNPLKALEIFNE 33