BLASTX nr result
ID: Mentha25_contig00051224
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00051224 (458 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007014350.1| Pentatricopeptide repeat (PPR) superfamily p... 72 6e-11 ref|XP_006492928.1| PREDICTED: pentatricopeptide repeat-containi... 67 2e-09 ref|XP_006421323.1| hypothetical protein CICLE_v10004347mg [Citr... 66 4e-09 ref|XP_006389878.1| hypothetical protein EUTSA_v10018150mg [Eutr... 66 4e-09 ref|XP_006301385.1| hypothetical protein CARUB_v10021797mg [Caps... 64 2e-08 ref|NP_178072.1| pentatricopeptide repeat-containing protein [Ar... 64 3e-08 ref|XP_002529510.1| pentatricopeptide repeat-containing protein,... 62 1e-07 ref|XP_002308024.2| pentatricopeptide repeat-containing family p... 61 2e-07 ref|XP_002889252.1| pentatricopeptide repeat-containing protein ... 61 2e-07 emb|CBI29825.3| unnamed protein product [Vitis vinifera] 61 2e-07 ref|XP_002278530.1| PREDICTED: pentatricopeptide repeat-containi... 61 2e-07 ref|XP_006340743.1| PREDICTED: pentatricopeptide repeat-containi... 57 4e-06 ref|XP_004233739.1| PREDICTED: pentatricopeptide repeat-containi... 56 6e-06 >ref|XP_007014350.1| Pentatricopeptide repeat (PPR) superfamily protein, putative [Theobroma cacao] gi|508784713|gb|EOY31969.1| Pentatricopeptide repeat (PPR) superfamily protein, putative [Theobroma cacao] Length = 800 Score = 72.4 bits (176), Expect = 6e-11 Identities = 38/89 (42%), Positives = 59/89 (66%) Frame = -2 Query: 277 SSFSSISDDALDNFTATNEVLALINSATPIEPALAKLSPLLNREVVISVIQSQAQWRKDP 98 SSFSS+ D F+ +NE+ ++++ P+EPAL L P L+ ++V S+IQ Q +P Sbjct: 27 SSFSSLQD-----FSVSNEIHSILDIVNPMEPALEPLLPFLSPDIVTSIIQDQ----PNP 77 Query: 97 VICFRFFVWASQTERFRSRFSNRLMVDIL 11 + FRFF+WA Q +R RS S++L+VD+L Sbjct: 78 QLGFRFFIWAMQRKRLRSSASDKLVVDML 106 >ref|XP_006492928.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79540-like [Citrus sinensis] Length = 869 Score = 67.4 bits (163), Expect = 2e-09 Identities = 43/123 (34%), Positives = 67/123 (54%), Gaps = 3/123 (2%) Frame = -2 Query: 370 NEHEYPIFSTTIMQKFLQIFRAIRPQH-FTPKSS--FSSISDDALDNFTATNEVLALINS 200 NE+ + + M+ + R I H F+PK S F + + + NEVL ++++ Sbjct: 57 NENIITLLCKSAMKLPSLLLRPISSAHQFSPKLSPPFHYLHSPSSAESSTINEVLTILDT 116 Query: 199 ATPIEPALAKLSPLLNREVVISVIQSQAQWRKDPVICFRFFVWASQTERFRSRFSNRLMV 20 TPIEPAL L P L++ V SVI K+P + FRFF+WA++ +R RS SN ++ Sbjct: 117 VTPIEPALEPLLPFLSKTTVTSVIMK----TKNPQVGFRFFIWAAKRKRLRSFASNSAVI 172 Query: 19 DIL 11 +L Sbjct: 173 RML 175 >ref|XP_006421323.1| hypothetical protein CICLE_v10004347mg [Citrus clementina] gi|557523196|gb|ESR34563.1| hypothetical protein CICLE_v10004347mg [Citrus clementina] Length = 801 Score = 66.2 bits (160), Expect = 4e-09 Identities = 40/105 (38%), Positives = 60/105 (57%), Gaps = 3/105 (2%) Frame = -2 Query: 316 IFRAIRPQH-FTPKSS--FSSISDDALDNFTATNEVLALINSATPIEPALAKLSPLLNRE 146 + R I H F+PK S F + + + NEVL ++++ TPIEPAL L P L++ Sbjct: 7 LLRPISSAHQFSPKLSPPFHYLHSPSSAESSTINEVLTILDTVTPIEPALEPLLPFLSKT 66 Query: 145 VVISVIQSQAQWRKDPVICFRFFVWASQTERFRSRFSNRLMVDIL 11 V SVI K+P + FRFF+WA++ +R RS SN ++ +L Sbjct: 67 TVTSVIMK----TKNPQVGFRFFIWAAKRKRLRSFASNSAVIRML 107 >ref|XP_006389878.1| hypothetical protein EUTSA_v10018150mg [Eutrema salsugineum] gi|557086312|gb|ESQ27164.1| hypothetical protein EUTSA_v10018150mg [Eutrema salsugineum] Length = 781 Score = 66.2 bits (160), Expect = 4e-09 Identities = 34/77 (44%), Positives = 51/77 (66%) Frame = -2 Query: 238 FTATNEVLALINSATPIEPALAKLSPLLNREVVISVIQSQAQWRKDPVICFRFFVWASQT 59 F EV++++ PIEPAL L P L+++++ SVI+ Q + + FRFF+WAS+ Sbjct: 33 FNIAGEVISILAKKKPIEPALEPLVPFLSQKIITSVIKDQVNRQ----LGFRFFIWASRR 88 Query: 58 ERFRSRFSNRLMVDILS 8 ER RSR S RL+++ILS Sbjct: 89 ERLRSRESFRLVINILS 105 >ref|XP_006301385.1| hypothetical protein CARUB_v10021797mg [Capsella rubella] gi|482570095|gb|EOA34283.1| hypothetical protein CARUB_v10021797mg [Capsella rubella] Length = 780 Score = 63.9 bits (154), Expect = 2e-08 Identities = 32/77 (41%), Positives = 51/77 (66%) Frame = -2 Query: 238 FTATNEVLALINSATPIEPALAKLSPLLNREVVISVIQSQAQWRKDPVICFRFFVWASQT 59 F + EV++++ PIEPAL L P L+ +++ SVI+ + +P + FRFF+WAS+ Sbjct: 31 FNISGEVISILAKKKPIEPALEPLVPFLSNKIITSVIKDEV----NPRLGFRFFIWASRR 86 Query: 58 ERFRSRFSNRLMVDILS 8 ER RSR S L++++LS Sbjct: 87 ERLRSRDSFGLVINMLS 103 >ref|NP_178072.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75200774|sp|Q9SAJ5.1|PP133_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At1g79540 gi|4835755|gb|AAD30222.1|AC007202_4 Contains similarity to gi|2827663 F18F4.190 membrane-associated salt-inducible-like protein from Arabidopsis thaliana BAC gb|AL021637 [Arabidopsis thaliana] gi|332198140|gb|AEE36261.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 780 Score = 63.5 bits (153), Expect = 3e-08 Identities = 32/77 (41%), Positives = 50/77 (64%) Frame = -2 Query: 238 FTATNEVLALINSATPIEPALAKLSPLLNREVVISVIQSQAQWRKDPVICFRFFVWASQT 59 F + EV++++ PIEPAL L P L++ ++ SVI+ + + + FRFF+WAS+ Sbjct: 31 FNISGEVISILAKKKPIEPALEPLVPFLSKNIITSVIKDEVNRQ----LGFRFFIWASRR 86 Query: 58 ERFRSRFSNRLMVDILS 8 ER RSR S L++D+LS Sbjct: 87 ERLRSRESFGLVIDMLS 103 >ref|XP_002529510.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223531026|gb|EEF32879.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 804 Score = 61.6 bits (148), Expect = 1e-07 Identities = 39/108 (36%), Positives = 61/108 (56%) Frame = -2 Query: 334 MQKFLQIFRAIRPQHFTPKSSFSSISDDALDNFTATNEVLALINSATPIEPALAKLSPLL 155 M+K + R I K F + S A+D F +NEVL +I+S PIEPAL P L Sbjct: 1 MKKLRSLLREISRAKPPWKQHFHTYS--AVD-FAISNEVLTIIDSVNPIEPALESKVPFL 57 Query: 154 NREVVISVIQSQAQWRKDPVICFRFFVWASQTERFRSRFSNRLMVDIL 11 + +V +I++ + ++ FRFF+WAS+ R RS S+ +++D+L Sbjct: 58 SPSIVTYIIKNP----PNSLLGFRFFIWASKFRRLRSWVSHNMIIDML 101 >ref|XP_002308024.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|550335473|gb|EEE91547.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 838 Score = 60.8 bits (146), Expect = 2e-07 Identities = 35/97 (36%), Positives = 59/97 (60%), Gaps = 2/97 (2%) Frame = -2 Query: 295 QHFT-PKSSF-SSISDDALDNFTATNEVLALINSATPIEPALAKLSPLLNREVVISVIQS 122 +HF+ PK + S+ A+ + ++EV +I + P+EPAL + P L+ ++V S+IQ+ Sbjct: 9 RHFSHPKPPWVQSLHTSAIQETSISDEVFTVIKTMNPMEPALEPMVPFLSPKIVTSIIQN 68 Query: 121 QAQWRKDPVICFRFFVWASQTERFRSRFSNRLMVDIL 11 +P + FRFF+WAS +RFR+ S L+ D+L Sbjct: 69 P----PNPQLGFRFFIWASNFKRFRAWESCDLITDLL 101 >ref|XP_002889252.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297335093|gb|EFH65511.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 780 Score = 60.8 bits (146), Expect = 2e-07 Identities = 31/77 (40%), Positives = 49/77 (63%) Frame = -2 Query: 238 FTATNEVLALINSATPIEPALAKLSPLLNREVVISVIQSQAQWRKDPVICFRFFVWASQT 59 F + EV++++ PIEPAL L P L++ ++ SVI+ + + + FRFF+WAS+ Sbjct: 31 FNISGEVISILAKKKPIEPALEPLVPFLSKNIITSVIKEEVNRQ----LGFRFFIWASRR 86 Query: 58 ERFRSRFSNRLMVDILS 8 ER RS S L++D+LS Sbjct: 87 ERLRSGESFGLVIDMLS 103 >emb|CBI29825.3| unnamed protein product [Vitis vinifera] Length = 722 Score = 60.8 bits (146), Expect = 2e-07 Identities = 38/113 (33%), Positives = 64/113 (56%), Gaps = 9/113 (7%) Frame = -2 Query: 319 QIFRAIRPQHFTPKSS---------FSSISDDALDNFTATNEVLALINSATPIEPALAKL 167 QI R++ HF PK S F++ A+ +NEVL ++ + P+E AL KL Sbjct: 6 QICRSVL--HFIPKQSRFRCLHANLFTTAQGAAI-----SNEVLTVMETVNPMEDALEKL 58 Query: 166 SPLLNREVVISVIQSQAQWRKDPVICFRFFVWASQTERFRSRFSNRLMVDILS 8 +P L+ E+V V++ Q + P + FRFF+W ++ FRS ++ L++D+L+ Sbjct: 59 APFLSSEIVNDVMREQ----RRPELGFRFFIWTTRRRSFRSWVTHNLVIDMLA 107 >ref|XP_002278530.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79540-like [Vitis vinifera] Length = 798 Score = 60.8 bits (146), Expect = 2e-07 Identities = 38/113 (33%), Positives = 64/113 (56%), Gaps = 9/113 (7%) Frame = -2 Query: 319 QIFRAIRPQHFTPKSS---------FSSISDDALDNFTATNEVLALINSATPIEPALAKL 167 QI R++ HF PK S F++ A+ +NEVL ++ + P+E AL KL Sbjct: 6 QICRSVL--HFIPKQSRFRCLHANLFTTAQGAAI-----SNEVLTVMETVNPMEDALEKL 58 Query: 166 SPLLNREVVISVIQSQAQWRKDPVICFRFFVWASQTERFRSRFSNRLMVDILS 8 +P L+ E+V V++ Q + P + FRFF+W ++ FRS ++ L++D+L+ Sbjct: 59 APFLSSEIVNDVMREQ----RRPELGFRFFIWTTRRRSFRSWVTHNLVIDMLA 107 >ref|XP_006340743.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79540-like [Solanum tuberosum] Length = 775 Score = 56.6 bits (135), Expect = 4e-06 Identities = 28/74 (37%), Positives = 47/74 (63%) Frame = -2 Query: 229 TNEVLALINSATPIEPALAKLSPLLNREVVISVIQSQAQWRKDPVICFRFFVWASQTERF 50 +NEVL +I P+EPAL KL L ++ +++ + RK+P + FRFF+WA++ +RF Sbjct: 26 SNEVLNIIERVDPLEPALDKLVRFLCPNIISFILEEK---RKNPELGFRFFIWAAKRKRF 82 Query: 49 RSRFSNRLMVDILS 8 +S L+ D+L+ Sbjct: 83 QSWVPKNLIADMLA 96 >ref|XP_004233739.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79540-like [Solanum lycopersicum] Length = 753 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/74 (36%), Positives = 48/74 (64%) Frame = -2 Query: 229 TNEVLALINSATPIEPALAKLSPLLNREVVISVIQSQAQWRKDPVICFRFFVWASQTERF 50 +NEVL +I+ P+EPAL +L L +++ +++ + RK+P + FRFF+WA++ +RF Sbjct: 4 SNEVLNIIDRVDPLEPALDELVRFLCPDIISFILEEK---RKNPELGFRFFIWAAKRKRF 60 Query: 49 RSRFSNRLMVDILS 8 + L+ D+LS Sbjct: 61 QRWIPKNLIADMLS 74