BLASTX nr result
ID: Mentha25_contig00051188
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00051188 (441 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADB85290.1| putative retrotransposon protein [Phyllostachys e... 56 5e-06 emb|CAE03590.1| OSJNBa0087O24.13 [Oryza sativa Japonica Group] 55 8e-06 >gb|ADB85290.1| putative retrotransposon protein [Phyllostachys edulis] Length = 592 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/35 (68%), Positives = 29/35 (82%) Frame = -2 Query: 335 SCYTLQRPGLLQPLPIPYIAWSHIYMDFIEGLPKS 231 +C + PGLLQP+PIP +AW+HI MDFIEGLPKS Sbjct: 353 NCEHVPYPGLLQPIPIPEMAWTHISMDFIEGLPKS 387 >emb|CAE03590.1| OSJNBa0087O24.13 [Oryza sativa Japonica Group] Length = 1311 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = -2 Query: 317 RPGLLQPLPIPYIAWSHIYMDFIEGLPKSVNE 222 +PGLL PLPIP +AW+HI MDFIEGLPKS N+ Sbjct: 949 QPGLLHPLPIPEMAWTHISMDFIEGLPKSDNK 980