BLASTX nr result
ID: Mentha25_contig00050903
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00050903 (392 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU31981.1| hypothetical protein MIMGU_mgv1a006251mg [Mimulus... 61 1e-07 >gb|EYU31981.1| hypothetical protein MIMGU_mgv1a006251mg [Mimulus guttatus] Length = 450 Score = 61.2 bits (147), Expect = 1e-07 Identities = 31/39 (79%), Positives = 34/39 (87%) Frame = +2 Query: 275 SWGLGKSSILTVKKASQLRVVASVATAEKPSTVPEIVLQ 391 SW L KSSI TVKK +QL+V A+VATAEKPSTVPEIVLQ Sbjct: 44 SWVLNKSSIFTVKKTTQLKVSAAVATAEKPSTVPEIVLQ 82