BLASTX nr result
ID: Mentha25_contig00050889
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00050889 (303 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU43995.1| hypothetical protein MIMGU_mgv1a002550mg [Mimulus... 69 5e-10 >gb|EYU43995.1| hypothetical protein MIMGU_mgv1a002550mg [Mimulus guttatus] Length = 660 Score = 69.3 bits (168), Expect = 5e-10 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = -2 Query: 104 ASDACNGVFLTYSYSTGKIVPPILKTDPARQGYR 3 ASDACNG+FLTY+Y+TGKIVPPILK DPARQGYR Sbjct: 37 ASDACNGIFLTYTYATGKIVPPILKRDPARQGYR 70