BLASTX nr result
ID: Mentha25_contig00050869
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00050869 (321 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU37711.1| hypothetical protein MIMGU_mgv1a006222mg [Mimulus... 73 5e-11 ref|XP_007042360.1| ARM repeat superfamily protein isoform 1 [Th... 70 2e-10 ref|XP_006480137.1| PREDICTED: armadillo repeat-containing prote... 70 4e-10 ref|XP_006423068.1| hypothetical protein CICLE_v10028211mg [Citr... 70 4e-10 ref|XP_007153167.1| hypothetical protein PHAVU_003G012500g [Phas... 69 5e-10 ref|XP_006352081.1| PREDICTED: armadillo repeat-containing prote... 69 7e-10 ref|XP_004250754.1| PREDICTED: armadillo repeat-containing prote... 69 7e-10 ref|XP_003529247.1| PREDICTED: armadillo repeat-containing prote... 69 7e-10 ref|XP_006384445.1| armadillo/beta-catenin repeat family protein... 69 9e-10 ref|XP_006829407.1| hypothetical protein AMTR_s00128p00071310 [A... 68 2e-09 ref|XP_002521847.1| Armadillo repeat-containing protein, putativ... 68 2e-09 gb|EPS61334.1| hypothetical protein M569_13461, partial [Genlise... 67 3e-09 ref|XP_004498168.1| PREDICTED: armadillo repeat-containing prote... 67 3e-09 ref|XP_006647944.1| PREDICTED: armadillo repeat-containing prote... 66 4e-09 ref|XP_004165806.1| PREDICTED: armadillo repeat-containing prote... 66 6e-09 ref|XP_004136992.1| PREDICTED: armadillo repeat-containing prote... 66 6e-09 ref|XP_002281840.1| PREDICTED: armadillo repeat-containing prote... 65 8e-09 gb|EXC17381.1| Armadillo repeat-containing protein 6 [Morus nota... 65 1e-08 gb|ACJ85697.1| unknown [Medicago truncatula] gi|388518985|gb|AFK... 65 1e-08 ref|XP_004292452.1| PREDICTED: armadillo repeat-containing prote... 64 2e-08 >gb|EYU37711.1| hypothetical protein MIMGU_mgv1a006222mg [Mimulus guttatus] Length = 452 Score = 72.8 bits (177), Expect = 5e-11 Identities = 34/41 (82%), Positives = 38/41 (92%) Frame = -1 Query: 321 RKLLLANGIEQLIRKAKQSHKSCKDAATDALRDLGLDNYNS 199 RK+LLA GIE+LIR+AKQ HK CKDAATDALRDLG+DNYNS Sbjct: 412 RKILLAIGIEELIRRAKQRHKGCKDAATDALRDLGVDNYNS 452 >ref|XP_007042360.1| ARM repeat superfamily protein isoform 1 [Theobroma cacao] gi|590686374|ref|XP_007042361.1| ARM repeat superfamily protein isoform 1 [Theobroma cacao] gi|508706295|gb|EOX98191.1| ARM repeat superfamily protein isoform 1 [Theobroma cacao] gi|508706296|gb|EOX98192.1| ARM repeat superfamily protein isoform 1 [Theobroma cacao] Length = 467 Score = 70.5 bits (171), Expect = 2e-10 Identities = 33/41 (80%), Positives = 38/41 (92%) Frame = -1 Query: 321 RKLLLANGIEQLIRKAKQSHKSCKDAATDALRDLGLDNYNS 199 R LLL NGI++ IRKAK++H+SCKDAATDALRDLGLDNYNS Sbjct: 427 RILLLNNGIDKFIRKAKENHESCKDAATDALRDLGLDNYNS 467 >ref|XP_006480137.1| PREDICTED: armadillo repeat-containing protein 6-like [Citrus sinensis] Length = 669 Score = 69.7 bits (169), Expect = 4e-10 Identities = 31/40 (77%), Positives = 39/40 (97%) Frame = -1 Query: 321 RKLLLANGIEQLIRKAKQSHKSCKDAATDALRDLGLDNYN 202 RKLLL+NG+E+LIR+AK++H+ CKDAATDALRDLGLD+YN Sbjct: 629 RKLLLSNGVEKLIRQAKENHEICKDAATDALRDLGLDDYN 668 >ref|XP_006423068.1| hypothetical protein CICLE_v10028211mg [Citrus clementina] gi|557525002|gb|ESR36308.1| hypothetical protein CICLE_v10028211mg [Citrus clementina] Length = 520 Score = 69.7 bits (169), Expect = 4e-10 Identities = 31/40 (77%), Positives = 39/40 (97%) Frame = -1 Query: 321 RKLLLANGIEQLIRKAKQSHKSCKDAATDALRDLGLDNYN 202 RKLLL+NG+E+LIR+AK++H+ CKDAATDALRDLGLD+YN Sbjct: 480 RKLLLSNGVEKLIRQAKENHEICKDAATDALRDLGLDDYN 519 >ref|XP_007153167.1| hypothetical protein PHAVU_003G012500g [Phaseolus vulgaris] gi|561026521|gb|ESW25161.1| hypothetical protein PHAVU_003G012500g [Phaseolus vulgaris] Length = 456 Score = 69.3 bits (168), Expect = 5e-10 Identities = 32/40 (80%), Positives = 36/40 (90%) Frame = -1 Query: 321 RKLLLANGIEQLIRKAKQSHKSCKDAATDALRDLGLDNYN 202 R +LL NGIE+ IRKAKQ+H +CKDAATDALRDLGLDNYN Sbjct: 416 RTILLNNGIEKYIRKAKQTHSNCKDAATDALRDLGLDNYN 455 >ref|XP_006352081.1| PREDICTED: armadillo repeat-containing protein 6-like isoform X1 [Solanum tuberosum] Length = 461 Score = 68.9 bits (167), Expect = 7e-10 Identities = 32/40 (80%), Positives = 37/40 (92%) Frame = -1 Query: 321 RKLLLANGIEQLIRKAKQSHKSCKDAATDALRDLGLDNYN 202 R +LL NGIE+LIRKAK ++KSCK+AATDALRDLGLDNYN Sbjct: 421 RTILLGNGIEKLIRKAKMNYKSCKNAATDALRDLGLDNYN 460 >ref|XP_004250754.1| PREDICTED: armadillo repeat-containing protein 6-like [Solanum lycopersicum] Length = 466 Score = 68.9 bits (167), Expect = 7e-10 Identities = 32/40 (80%), Positives = 37/40 (92%) Frame = -1 Query: 321 RKLLLANGIEQLIRKAKQSHKSCKDAATDALRDLGLDNYN 202 R +LL NGIE+LIRKAK ++KSCK+AATDALRDLGLDNYN Sbjct: 426 RTILLGNGIEKLIRKAKMNYKSCKNAATDALRDLGLDNYN 465 >ref|XP_003529247.1| PREDICTED: armadillo repeat-containing protein 6 [Glycine max] Length = 463 Score = 68.9 bits (167), Expect = 7e-10 Identities = 32/40 (80%), Positives = 36/40 (90%) Frame = -1 Query: 321 RKLLLANGIEQLIRKAKQSHKSCKDAATDALRDLGLDNYN 202 R +LL NGIE+ IRKAKQ+H +CKDAATDALRDLGLDNYN Sbjct: 423 RTILLNNGIEKYIRKAKQTHTNCKDAATDALRDLGLDNYN 462 >ref|XP_006384445.1| armadillo/beta-catenin repeat family protein [Populus trichocarpa] gi|550341063|gb|ERP62242.1| armadillo/beta-catenin repeat family protein [Populus trichocarpa] Length = 461 Score = 68.6 bits (166), Expect = 9e-10 Identities = 31/41 (75%), Positives = 39/41 (95%) Frame = -1 Query: 321 RKLLLANGIEQLIRKAKQSHKSCKDAATDALRDLGLDNYNS 199 R LLL++GIE++IR+AK +H++CKDAATDALRDLGLDNYNS Sbjct: 421 RTLLLSHGIEKIIRRAKVNHETCKDAATDALRDLGLDNYNS 461 >ref|XP_006829407.1| hypothetical protein AMTR_s00128p00071310 [Amborella trichopoda] gi|548834761|gb|ERM96823.1| hypothetical protein AMTR_s00128p00071310 [Amborella trichopoda] Length = 485 Score = 67.8 bits (164), Expect = 2e-09 Identities = 31/40 (77%), Positives = 36/40 (90%) Frame = -1 Query: 321 RKLLLANGIEQLIRKAKQSHKSCKDAATDALRDLGLDNYN 202 R +LL NGIE L+RKAK++H+SCKDAAT ALRDLGLDNYN Sbjct: 445 RSILLNNGIETLVRKAKENHESCKDAATAALRDLGLDNYN 484 >ref|XP_002521847.1| Armadillo repeat-containing protein, putative [Ricinus communis] gi|223538885|gb|EEF40483.1| Armadillo repeat-containing protein, putative [Ricinus communis] Length = 719 Score = 67.8 bits (164), Expect = 2e-09 Identities = 31/38 (81%), Positives = 36/38 (94%) Frame = -1 Query: 315 LLLANGIEQLIRKAKQSHKSCKDAATDALRDLGLDNYN 202 LLL++GIE +IRKAK SH++CKDAATDALRDLGLDNYN Sbjct: 681 LLLSHGIENIIRKAKASHETCKDAATDALRDLGLDNYN 718 >gb|EPS61334.1| hypothetical protein M569_13461, partial [Genlisea aurea] Length = 452 Score = 67.0 bits (162), Expect = 3e-09 Identities = 31/42 (73%), Positives = 40/42 (95%), Gaps = 1/42 (2%) Frame = -1 Query: 321 RKLLLANGIEQLIRKAKQSH-KSCKDAATDALRDLGLDNYNS 199 RK+L++NGIE LIR+AK++H ++CKDAATDALRDLG+DNYNS Sbjct: 411 RKILVSNGIEALIRRAKENHGRTCKDAATDALRDLGVDNYNS 452 >ref|XP_004498168.1| PREDICTED: armadillo repeat-containing protein 6-like [Cicer arietinum] Length = 459 Score = 66.6 bits (161), Expect = 3e-09 Identities = 31/40 (77%), Positives = 36/40 (90%) Frame = -1 Query: 321 RKLLLANGIEQLIRKAKQSHKSCKDAATDALRDLGLDNYN 202 R +LL NGIE+ IRKAKQ+H +CKDAATDALRDLGLD+YN Sbjct: 419 RTILLNNGIEKYIRKAKQTHGNCKDAATDALRDLGLDSYN 458 >ref|XP_006647944.1| PREDICTED: armadillo repeat-containing protein 6-like [Oryza brachyantha] Length = 463 Score = 66.2 bits (160), Expect = 4e-09 Identities = 31/41 (75%), Positives = 35/41 (85%) Frame = -1 Query: 321 RKLLLANGIEQLIRKAKQSHKSCKDAATDALRDLGLDNYNS 199 R +LL NG+E+LIRKAK H SCKDAAT ALRDLG+DNYNS Sbjct: 423 RTILLNNGVEKLIRKAKVMHASCKDAATSALRDLGVDNYNS 463 >ref|XP_004165806.1| PREDICTED: armadillo repeat-containing protein 6-like [Cucumis sativus] Length = 465 Score = 65.9 bits (159), Expect = 6e-09 Identities = 31/39 (79%), Positives = 35/39 (89%) Frame = -1 Query: 321 RKLLLANGIEQLIRKAKQSHKSCKDAATDALRDLGLDNY 205 R LLL GIE+ IRKAKQ+H+SCKDAA+DALRDLGLDNY Sbjct: 426 RALLLKTGIEKYIRKAKQNHESCKDAASDALRDLGLDNY 464 >ref|XP_004136992.1| PREDICTED: armadillo repeat-containing protein 6-like [Cucumis sativus] Length = 465 Score = 65.9 bits (159), Expect = 6e-09 Identities = 31/39 (79%), Positives = 35/39 (89%) Frame = -1 Query: 321 RKLLLANGIEQLIRKAKQSHKSCKDAATDALRDLGLDNY 205 R LLL GIE+ IRKAKQ+H+SCKDAA+DALRDLGLDNY Sbjct: 426 RALLLKTGIEKYIRKAKQNHESCKDAASDALRDLGLDNY 464 >ref|XP_002281840.1| PREDICTED: armadillo repeat-containing protein 6 [Vitis vinifera] gi|297741329|emb|CBI32460.3| unnamed protein product [Vitis vinifera] Length = 460 Score = 65.5 bits (158), Expect = 8e-09 Identities = 32/41 (78%), Positives = 38/41 (92%) Frame = -1 Query: 321 RKLLLANGIEQLIRKAKQSHKSCKDAATDALRDLGLDNYNS 199 R LLL+NGIE++IRKAK++H+SCKDAA DALRDLGLD YNS Sbjct: 421 RTLLLSNGIEKIIRKAKENHESCKDAANDALRDLGLD-YNS 460 >gb|EXC17381.1| Armadillo repeat-containing protein 6 [Morus notabilis] Length = 462 Score = 64.7 bits (156), Expect = 1e-08 Identities = 29/40 (72%), Positives = 36/40 (90%) Frame = -1 Query: 321 RKLLLANGIEQLIRKAKQSHKSCKDAATDALRDLGLDNYN 202 R LL NG+ +LIR+AKQ+H+SCK+AATDALRDLGLD+YN Sbjct: 422 RTFLLNNGVSKLIRQAKQNHESCKEAATDALRDLGLDDYN 461 >gb|ACJ85697.1| unknown [Medicago truncatula] gi|388518985|gb|AFK47554.1| unknown [Medicago truncatula] Length = 459 Score = 64.7 bits (156), Expect = 1e-08 Identities = 30/40 (75%), Positives = 36/40 (90%) Frame = -1 Query: 321 RKLLLANGIEQLIRKAKQSHKSCKDAATDALRDLGLDNYN 202 R +LL NGIE+ IRKAKQ+H +CK+AATDALRDLGLD+YN Sbjct: 419 RTILLNNGIEKHIRKAKQTHANCKEAATDALRDLGLDSYN 458 >ref|XP_004292452.1| PREDICTED: armadillo repeat-containing protein 6-like [Fragaria vesca subsp. vesca] Length = 460 Score = 64.3 bits (155), Expect = 2e-08 Identities = 29/40 (72%), Positives = 36/40 (90%) Frame = -1 Query: 321 RKLLLANGIEQLIRKAKQSHKSCKDAATDALRDLGLDNYN 202 R +LL +G+E+ IRKAKQ+H SCK+AATDALRDLGLD+YN Sbjct: 420 RTILLNSGVEKCIRKAKQTHPSCKEAATDALRDLGLDDYN 459