BLASTX nr result
ID: Mentha25_contig00050712
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00050712 (572 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004309488.1| PREDICTED: staphylococcal nuclease domain-co... 64 3e-08 gb|EYU24546.1| hypothetical protein MIMGU_mgv1a000773mg [Mimulus... 63 6e-08 gb|EXB79410.1| nuclease domain-containing protein 1 [Morus notab... 62 8e-08 ref|XP_006341451.1| PREDICTED: staphylococcal nuclease domain-co... 62 8e-08 ref|XP_007210402.1| hypothetical protein PRUPE_ppa000817mg [Prun... 62 8e-08 ref|XP_004235862.1| PREDICTED: staphylococcal nuclease domain-co... 62 8e-08 ref|XP_002273150.1| PREDICTED: staphylococcal nuclease domain-co... 62 8e-08 ref|XP_002511064.1| ebna2 binding protein P100, putative [Ricinu... 62 8e-08 ref|XP_002322312.1| 110 kDa 4SNc-Tudor domain family protein [Po... 62 8e-08 emb|CAN83456.1| hypothetical protein VITISV_034601 [Vitis vinifera] 62 8e-08 ref|XP_004138013.1| PREDICTED: staphylococcal nuclease domain-co... 62 1e-07 ref|XP_006341449.1| PREDICTED: staphylococcal nuclease domain-co... 62 1e-07 ref|XP_004235861.1| PREDICTED: staphylococcal nuclease domain-co... 62 1e-07 ref|XP_002318790.2| hypothetical protein POPTR_0012s11300g [Popu... 61 2e-07 ref|XP_006436997.1| hypothetical protein CICLE_v10030606mg [Citr... 61 2e-07 ref|XP_006436996.1| hypothetical protein CICLE_v10030606mg [Citr... 61 2e-07 ref|XP_006436995.1| hypothetical protein CICLE_v10030606mg [Citr... 61 2e-07 ref|XP_006436994.1| hypothetical protein CICLE_v10030606mg [Citr... 61 2e-07 gb|ADN33852.1| short-chain dehydrogenase/reductase [Cucumis melo... 60 4e-07 ref|XP_006844693.1| hypothetical protein AMTR_s00016p00246090 [A... 60 5e-07 >ref|XP_004309488.1| PREDICTED: staphylococcal nuclease domain-containing protein 1-like [Fragaria vesca subsp. vesca] Length = 995 Score = 63.9 bits (154), Expect = 3e-08 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -1 Query: 572 EAPLIGAFNPKKGDVVLAQFSADKSWNRAMV 480 EAPLIGAFNPKKGDVVLAQFSAD SWNRAM+ Sbjct: 780 EAPLIGAFNPKKGDVVLAQFSADNSWNRAMI 810 >gb|EYU24546.1| hypothetical protein MIMGU_mgv1a000773mg [Mimulus guttatus] Length = 989 Score = 62.8 bits (151), Expect = 6e-08 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -1 Query: 572 EAPLIGAFNPKKGDVVLAQFSADKSWNRAMV 480 + PLIGAFNPKKGD+VLAQFSADKSWNRAM+ Sbjct: 771 DTPLIGAFNPKKGDIVLAQFSADKSWNRAMI 801 >gb|EXB79410.1| nuclease domain-containing protein 1 [Morus notabilis] Length = 986 Score = 62.4 bits (150), Expect = 8e-08 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -1 Query: 572 EAPLIGAFNPKKGDVVLAQFSADKSWNRAMV 480 EAP+IGAFNPKKGD+VLAQFSAD SWNRAM+ Sbjct: 769 EAPVIGAFNPKKGDIVLAQFSADNSWNRAMI 799 >ref|XP_006341451.1| PREDICTED: staphylococcal nuclease domain-containing protein 1-like isoform X1 [Solanum tuberosum] gi|565348928|ref|XP_006341452.1| PREDICTED: staphylococcal nuclease domain-containing protein 1-like isoform X2 [Solanum tuberosum] Length = 978 Score = 62.4 bits (150), Expect = 8e-08 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -1 Query: 572 EAPLIGAFNPKKGDVVLAQFSADKSWNRAMV 480 EAP+IGAFNPKKGD+VLAQFSAD SWNRAM+ Sbjct: 763 EAPVIGAFNPKKGDIVLAQFSADNSWNRAMI 793 >ref|XP_007210402.1| hypothetical protein PRUPE_ppa000817mg [Prunus persica] gi|462406137|gb|EMJ11601.1| hypothetical protein PRUPE_ppa000817mg [Prunus persica] Length = 994 Score = 62.4 bits (150), Expect = 8e-08 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -1 Query: 572 EAPLIGAFNPKKGDVVLAQFSADKSWNRAMV 480 EAP+IGAFNPKKGD+VLAQFSAD SWNRAM+ Sbjct: 777 EAPVIGAFNPKKGDIVLAQFSADNSWNRAMI 807 >ref|XP_004235862.1| PREDICTED: staphylococcal nuclease domain-containing protein 1-like [Solanum lycopersicum] Length = 978 Score = 62.4 bits (150), Expect = 8e-08 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -1 Query: 572 EAPLIGAFNPKKGDVVLAQFSADKSWNRAMV 480 EAP+IGAFNPKKGD+VLAQFSAD SWNRAM+ Sbjct: 763 EAPVIGAFNPKKGDIVLAQFSADNSWNRAMI 793 >ref|XP_002273150.1| PREDICTED: staphylococcal nuclease domain-containing protein 1 [Vitis vinifera] gi|296088151|emb|CBI35621.3| unnamed protein product [Vitis vinifera] Length = 1000 Score = 62.4 bits (150), Expect = 8e-08 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -1 Query: 572 EAPLIGAFNPKKGDVVLAQFSADKSWNRAMV 480 EAP+IGAFNPKKGD+VLAQFSAD SWNRAM+ Sbjct: 776 EAPVIGAFNPKKGDIVLAQFSADNSWNRAMI 806 >ref|XP_002511064.1| ebna2 binding protein P100, putative [Ricinus communis] gi|223550179|gb|EEF51666.1| ebna2 binding protein P100, putative [Ricinus communis] Length = 988 Score = 62.4 bits (150), Expect = 8e-08 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -1 Query: 572 EAPLIGAFNPKKGDVVLAQFSADKSWNRAMV 480 EAP+IGAFNPKKGD+VLAQFSAD SWNRAM+ Sbjct: 771 EAPVIGAFNPKKGDIVLAQFSADNSWNRAMI 801 >ref|XP_002322312.1| 110 kDa 4SNc-Tudor domain family protein [Populus trichocarpa] gi|222869308|gb|EEF06439.1| 110 kDa 4SNc-Tudor domain family protein [Populus trichocarpa] Length = 984 Score = 62.4 bits (150), Expect = 8e-08 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -1 Query: 572 EAPLIGAFNPKKGDVVLAQFSADKSWNRAMV 480 EAP+IGAFNPKKGD+VLAQFSAD SWNRAM+ Sbjct: 768 EAPVIGAFNPKKGDIVLAQFSADNSWNRAMI 798 >emb|CAN83456.1| hypothetical protein VITISV_034601 [Vitis vinifera] Length = 983 Score = 62.4 bits (150), Expect = 8e-08 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -1 Query: 572 EAPLIGAFNPKKGDVVLAQFSADKSWNRAMV 480 EAP+IGAFNPKKGD+VLAQFSAD SWNRAM+ Sbjct: 759 EAPVIGAFNPKKGDIVLAQFSADNSWNRAMI 789 >ref|XP_004138013.1| PREDICTED: staphylococcal nuclease domain-containing protein 1-like [Cucumis sativus] gi|449522262|ref|XP_004168146.1| PREDICTED: staphylococcal nuclease domain-containing protein 1-like [Cucumis sativus] Length = 988 Score = 62.0 bits (149), Expect = 1e-07 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -1 Query: 572 EAPLIGAFNPKKGDVVLAQFSADKSWNRAMV 480 E PLIGAFNPKKGD+VLAQFSAD SWNRAM+ Sbjct: 772 EVPLIGAFNPKKGDIVLAQFSADNSWNRAMI 802 >ref|XP_006341449.1| PREDICTED: staphylococcal nuclease domain-containing protein 1-like isoform X1 [Solanum tuberosum] gi|565348924|ref|XP_006341450.1| PREDICTED: staphylococcal nuclease domain-containing protein 1-like isoform X2 [Solanum tuberosum] Length = 978 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -1 Query: 572 EAPLIGAFNPKKGDVVLAQFSADKSWNRAMV 480 EAP+IGAFNPKKGD+VLAQFSAD SWNRAM+ Sbjct: 763 EAPVIGAFNPKKGDMVLAQFSADNSWNRAMI 793 >ref|XP_004235861.1| PREDICTED: staphylococcal nuclease domain-containing protein 1-like [Solanum lycopersicum] Length = 978 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -1 Query: 572 EAPLIGAFNPKKGDVVLAQFSADKSWNRAMV 480 EAP+IGAFNPKKGD+VLAQFSAD SWNRAM+ Sbjct: 763 EAPVIGAFNPKKGDMVLAQFSADNSWNRAMI 793 >ref|XP_002318790.2| hypothetical protein POPTR_0012s11300g [Populus trichocarpa] gi|550326869|gb|EEE97010.2| hypothetical protein POPTR_0012s11300g [Populus trichocarpa] Length = 970 Score = 61.2 bits (147), Expect = 2e-07 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = -1 Query: 572 EAPLIGAFNPKKGDVVLAQFSADKSWNRAMV 480 EAP+IGAFNPK+GD+VLAQFSAD SWNRAM+ Sbjct: 762 EAPVIGAFNPKRGDIVLAQFSADNSWNRAMI 792 >ref|XP_006436997.1| hypothetical protein CICLE_v10030606mg [Citrus clementina] gi|557539193|gb|ESR50237.1| hypothetical protein CICLE_v10030606mg [Citrus clementina] Length = 957 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = -1 Query: 572 EAPLIGAFNPKKGDVVLAQFSADKSWNRAMV 480 EAP+IGAFNPKKG++VLAQFSAD SWNRAM+ Sbjct: 801 EAPVIGAFNPKKGEIVLAQFSADNSWNRAMI 831 >ref|XP_006436996.1| hypothetical protein CICLE_v10030606mg [Citrus clementina] gi|557539192|gb|ESR50236.1| hypothetical protein CICLE_v10030606mg [Citrus clementina] Length = 881 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = -1 Query: 572 EAPLIGAFNPKKGDVVLAQFSADKSWNRAMV 480 EAP+IGAFNPKKG++VLAQFSAD SWNRAM+ Sbjct: 725 EAPVIGAFNPKKGEIVLAQFSADNSWNRAMI 755 >ref|XP_006436995.1| hypothetical protein CICLE_v10030606mg [Citrus clementina] gi|557539191|gb|ESR50235.1| hypothetical protein CICLE_v10030606mg [Citrus clementina] Length = 944 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = -1 Query: 572 EAPLIGAFNPKKGDVVLAQFSADKSWNRAMV 480 EAP+IGAFNPKKG++VLAQFSAD SWNRAM+ Sbjct: 725 EAPVIGAFNPKKGEIVLAQFSADNSWNRAMI 755 >ref|XP_006436994.1| hypothetical protein CICLE_v10030606mg [Citrus clementina] gi|568863227|ref|XP_006485058.1| PREDICTED: staphylococcal nuclease domain-containing protein 1-like [Citrus sinensis] gi|557539190|gb|ESR50234.1| hypothetical protein CICLE_v10030606mg [Citrus clementina] Length = 1020 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = -1 Query: 572 EAPLIGAFNPKKGDVVLAQFSADKSWNRAMV 480 EAP+IGAFNPKKG++VLAQFSAD SWNRAM+ Sbjct: 801 EAPVIGAFNPKKGEIVLAQFSADNSWNRAMI 831 >gb|ADN33852.1| short-chain dehydrogenase/reductase [Cucumis melo subsp. melo] Length = 988 Score = 60.1 bits (144), Expect = 4e-07 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -1 Query: 572 EAPLIGAFNPKKGDVVLAQFSADKSWNRAMV 480 E PLIGAF+PKKGD+VLAQFSAD SWNRAM+ Sbjct: 772 EVPLIGAFSPKKGDIVLAQFSADNSWNRAMI 802 >ref|XP_006844693.1| hypothetical protein AMTR_s00016p00246090 [Amborella trichopoda] gi|548847164|gb|ERN06368.1| hypothetical protein AMTR_s00016p00246090 [Amborella trichopoda] Length = 943 Score = 59.7 bits (143), Expect = 5e-07 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -1 Query: 572 EAPLIGAFNPKKGDVVLAQFSADKSWNRAMV 480 E PLIG FNPKKGD++LAQFSAD SWNRAM+ Sbjct: 726 EKPLIGGFNPKKGDIILAQFSADNSWNRAMI 756