BLASTX nr result
ID: Mentha25_contig00050606
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00050606 (361 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU19199.1| hypothetical protein MIMGU_mgv1a006892mg [Mimulus... 67 3e-09 >gb|EYU19199.1| hypothetical protein MIMGU_mgv1a006892mg [Mimulus guttatus] Length = 427 Score = 67.0 bits (162), Expect = 3e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +1 Query: 271 MGEKKKDTPSTVWFSLKKSLHCKSEPSDVH 360 MGEKKKDTP+TVWFSLKKSLHCKSEPSDVH Sbjct: 1 MGEKKKDTPATVWFSLKKSLHCKSEPSDVH 30