BLASTX nr result
ID: Mentha25_contig00050517
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00050517 (306 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU26942.1| hypothetical protein MIMGU_mgv1a0038152mg, partia... 69 5e-10 ref|XP_002533881.1| alpha/beta hydrolase domain containing prote... 69 7e-10 ref|XP_006349340.1| PREDICTED: embryogenesis-associated protein ... 65 1e-08 ref|XP_004230459.1| PREDICTED: embryogenesis-associated protein ... 64 3e-08 ref|XP_007020270.1| Alpha/beta-Hydrolases superfamily protein, p... 63 5e-08 ref|XP_004496353.1| PREDICTED: embryogenesis-associated protein ... 62 8e-08 ref|XP_003591996.1| Embryogenesis-associated protein EMB8 [Medic... 61 1e-07 ref|XP_006471159.1| PREDICTED: embryogenesis-associated protein ... 61 2e-07 ref|XP_006431681.1| hypothetical protein CICLE_v10001852mg [Citr... 61 2e-07 ref|XP_006846975.1| hypothetical protein AMTR_s00017p00089380 [A... 59 9e-07 ref|XP_006434632.1| hypothetical protein CICLE_v10001139mg [Citr... 58 1e-06 ref|XP_006385025.1| embryogenesis-associated family protein [Pop... 58 1e-06 ref|XP_007041252.1| Alpha/beta-Hydrolases superfamily protein, p... 58 1e-06 ref|XP_006473213.1| PREDICTED: embryogenesis-associated protein ... 58 2e-06 ref|XP_006473212.1| PREDICTED: embryogenesis-associated protein ... 58 2e-06 emb|CBI18536.3| unnamed protein product [Vitis vinifera] 58 2e-06 ref|XP_002266169.1| PREDICTED: embryogenesis-associated protein ... 58 2e-06 emb|CBI29717.3| unnamed protein product [Vitis vinifera] 57 3e-06 ref|XP_002263770.1| PREDICTED: embryogenesis-associated protein ... 57 3e-06 emb|CAN63261.1| hypothetical protein VITISV_036938 [Vitis vinifera] 57 3e-06 >gb|EYU26942.1| hypothetical protein MIMGU_mgv1a0038152mg, partial [Mimulus guttatus] Length = 248 Score = 69.3 bits (168), Expect = 5e-10 Identities = 35/58 (60%), Positives = 45/58 (77%) Frame = -1 Query: 303 EIVTPVVKCLNKLSRENRISVWLLAYIALATTWPLVGSAVSLFLKRRRLQPLLS*PSV 130 +I+ PV K LN+LSR+NR S+WLLAY+A+ TTWP+VG A+S FL RRR + L S SV Sbjct: 190 DIIAPVKKRLNQLSRQNRKSMWLLAYVAIVTTWPVVGPALSFFL-RRRFRNLFSPASV 246 >ref|XP_002533881.1| alpha/beta hydrolase domain containing protein 1,3, putative [Ricinus communis] gi|223526166|gb|EEF28499.1| alpha/beta hydrolase domain containing protein 1,3, putative [Ricinus communis] Length = 571 Score = 68.9 bits (167), Expect = 7e-10 Identities = 30/47 (63%), Positives = 42/47 (89%) Frame = -1 Query: 303 EIVTPVVKCLNKLSRENRISVWLLAYIALATTWPLVGSAVSLFLKRR 163 +++TPV + ++L+R +RISVWLLAYIA+ATTWPLVGSA+ LF+KR+ Sbjct: 512 DLITPVKRYTSQLARHSRISVWLLAYIAIATTWPLVGSALLLFIKRK 558 >ref|XP_006349340.1| PREDICTED: embryogenesis-associated protein EMB8-like [Solanum tuberosum] Length = 579 Score = 65.1 bits (157), Expect = 1e-08 Identities = 25/46 (54%), Positives = 39/46 (84%) Frame = -1 Query: 300 IVTPVVKCLNKLSRENRISVWLLAYIALATTWPLVGSAVSLFLKRR 163 ++ PV +CLN+LSR ++IS+W+LAYIA+ TTWP++GSA +F K++ Sbjct: 525 VIVPVKRCLNQLSRRSKISMWVLAYIAIITTWPILGSASPMFFKKK 570 >ref|XP_004230459.1| PREDICTED: embryogenesis-associated protein EMB8-like [Solanum lycopersicum] Length = 583 Score = 63.5 bits (153), Expect = 3e-08 Identities = 24/46 (52%), Positives = 39/46 (84%) Frame = -1 Query: 300 IVTPVVKCLNKLSRENRISVWLLAYIALATTWPLVGSAVSLFLKRR 163 ++ PV +CLN+LS+ ++IS+W+LAYIA+ TTWP++GSA +F K++ Sbjct: 529 VIVPVKRCLNQLSQHSKISMWVLAYIAIITTWPILGSASPMFFKKK 574 >ref|XP_007020270.1| Alpha/beta-Hydrolases superfamily protein, putative [Theobroma cacao] gi|508725598|gb|EOY17495.1| Alpha/beta-Hydrolases superfamily protein, putative [Theobroma cacao] Length = 700 Score = 62.8 bits (151), Expect = 5e-08 Identities = 26/47 (55%), Positives = 38/47 (80%) Frame = -1 Query: 303 EIVTPVVKCLNKLSRENRISVWLLAYIALATTWPLVGSAVSLFLKRR 163 +++ V +CLN LSR+NR S+WLLAYIA+ T+WPLVGSA +F +++ Sbjct: 642 DVIAHVKRCLNHLSRQNRNSMWLLAYIAIITSWPLVGSAFRIFSRKK 688 >ref|XP_004496353.1| PREDICTED: embryogenesis-associated protein EMB8-like [Cicer arietinum] Length = 569 Score = 62.0 bits (149), Expect = 8e-08 Identities = 25/47 (53%), Positives = 39/47 (82%) Frame = -1 Query: 303 EIVTPVVKCLNKLSRENRISVWLLAYIALATTWPLVGSAVSLFLKRR 163 +++TP+ + + +LSR+NR+S+WLL YIA+ T+WPLVGSA+SL +R Sbjct: 520 DVLTPLKRYVGQLSRQNRLSIWLLVYIAITTSWPLVGSALSLVFGKR 566 >ref|XP_003591996.1| Embryogenesis-associated protein EMB8 [Medicago truncatula] gi|355481044|gb|AES62247.1| Embryogenesis-associated protein EMB8 [Medicago truncatula] Length = 575 Score = 61.2 bits (147), Expect = 1e-07 Identities = 27/47 (57%), Positives = 37/47 (78%) Frame = -1 Query: 303 EIVTPVVKCLNKLSRENRISVWLLAYIALATTWPLVGSAVSLFLKRR 163 ++VTP + L +LSR+NR S+WLLAYIA+ T+WPLVGSA+ L +R Sbjct: 517 DVVTPFKRYLGQLSRQNRWSIWLLAYIAITTSWPLVGSALHLVFGKR 563 >ref|XP_006471159.1| PREDICTED: embryogenesis-associated protein EMB8-like [Citrus sinensis] Length = 568 Score = 60.8 bits (146), Expect = 2e-07 Identities = 25/47 (53%), Positives = 39/47 (82%) Frame = -1 Query: 303 EIVTPVVKCLNKLSRENRISVWLLAYIALATTWPLVGSAVSLFLKRR 163 +++ P+ + +++LSR +RIS+WLL IA+ TTWPLVGSA+ LFL+R+ Sbjct: 510 DLIVPIRRRMDQLSRHSRISIWLLVCIAITTTWPLVGSALILFLRRK 556 >ref|XP_006431681.1| hypothetical protein CICLE_v10001852mg [Citrus clementina] gi|557533803|gb|ESR44921.1| hypothetical protein CICLE_v10001852mg [Citrus clementina] Length = 322 Score = 60.8 bits (146), Expect = 2e-07 Identities = 25/47 (53%), Positives = 39/47 (82%) Frame = -1 Query: 303 EIVTPVVKCLNKLSRENRISVWLLAYIALATTWPLVGSAVSLFLKRR 163 +++ P+ + +++LSR +RIS+WLL IA+ TTWPLVGSA+ LFL+R+ Sbjct: 264 DLIVPIRRRMDQLSRHSRISIWLLVCIAITTTWPLVGSALILFLRRK 310 >ref|XP_006846975.1| hypothetical protein AMTR_s00017p00089380 [Amborella trichopoda] gi|548850004|gb|ERN08556.1| hypothetical protein AMTR_s00017p00089380 [Amborella trichopoda] Length = 582 Score = 58.5 bits (140), Expect = 9e-07 Identities = 25/53 (47%), Positives = 42/53 (79%) Frame = -1 Query: 303 EIVTPVVKCLNKLSRENRISVWLLAYIALATTWPLVGSAVSLFLKRRRLQPLL 145 +++ P+ + +N+LSR NR S+W+L YIA+ TTWPLVGSA+ + L R++L+ ++ Sbjct: 524 DVMGPIKRSINQLSRNNRKSMWVLVYIAIVTTWPLVGSAL-IILARKKLRNVI 575 >ref|XP_006434632.1| hypothetical protein CICLE_v10001139mg [Citrus clementina] gi|557536754|gb|ESR47872.1| hypothetical protein CICLE_v10001139mg [Citrus clementina] Length = 448 Score = 58.2 bits (139), Expect = 1e-06 Identities = 24/48 (50%), Positives = 34/48 (70%) Frame = -1 Query: 306 REIVTPVVKCLNKLSRENRISVWLLAYIALATTWPLVGSAVSLFLKRR 163 R + V CLN+LS+ N+ S+WLLAY+A+ TTWPLVGSA+ ++ Sbjct: 389 RNLTASVTSCLNQLSQRNKRSMWLLAYVAIITTWPLVGSALRFIFGKK 436 >ref|XP_006385025.1| embryogenesis-associated family protein [Populus trichocarpa] gi|550341793|gb|ERP62822.1| embryogenesis-associated family protein [Populus trichocarpa] Length = 546 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/47 (57%), Positives = 37/47 (78%) Frame = -1 Query: 303 EIVTPVVKCLNKLSRENRISVWLLAYIALATTWPLVGSAVSLFLKRR 163 ++ PV + +++L R NR S+WLLAYIA+ TTWPLVGSA+ FLK+R Sbjct: 488 DLDVPVRRRMDQLLRLNRNSIWLLAYIAIVTTWPLVGSALLPFLKKR 534 >ref|XP_007041252.1| Alpha/beta-Hydrolases superfamily protein, putative isoform 1 [Theobroma cacao] gi|508705187|gb|EOX97083.1| Alpha/beta-Hydrolases superfamily protein, putative isoform 1 [Theobroma cacao] Length = 608 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/48 (52%), Positives = 37/48 (77%) Frame = -1 Query: 306 REIVTPVVKCLNKLSRENRISVWLLAYIALATTWPLVGSAVSLFLKRR 163 ++++ PV + +++LSR +R S+WLLAYIA+ TTWP VGS + LKRR Sbjct: 549 KDLIVPVQRRVDQLSRRSRRSIWLLAYIAIITTWPFVGSVLISVLKRR 596 >ref|XP_006473213.1| PREDICTED: embryogenesis-associated protein EMB8-like isoform X2 [Citrus sinensis] Length = 585 Score = 57.8 bits (138), Expect = 2e-06 Identities = 24/49 (48%), Positives = 34/49 (69%) Frame = -1 Query: 306 REIVTPVVKCLNKLSRENRISVWLLAYIALATTWPLVGSAVSLFLKRRR 160 R + V C N+LS+ N+ S+WLLAY+A+ TTWPLVGSA+ ++R Sbjct: 526 RNLTASVTSCWNQLSQRNKRSMWLLAYVAIITTWPLVGSALRFIFGKKR 574 >ref|XP_006473212.1| PREDICTED: embryogenesis-associated protein EMB8-like isoform X1 [Citrus sinensis] Length = 586 Score = 57.8 bits (138), Expect = 2e-06 Identities = 24/49 (48%), Positives = 34/49 (69%) Frame = -1 Query: 306 REIVTPVVKCLNKLSRENRISVWLLAYIALATTWPLVGSAVSLFLKRRR 160 R + V C N+LS+ N+ S+WLLAY+A+ TTWPLVGSA+ ++R Sbjct: 527 RNLTASVTSCWNQLSQRNKRSMWLLAYVAIITTWPLVGSALRFIFGKKR 575 >emb|CBI18536.3| unnamed protein product [Vitis vinifera] Length = 538 Score = 57.8 bits (138), Expect = 2e-06 Identities = 24/40 (60%), Positives = 31/40 (77%) Frame = -1 Query: 282 KCLNKLSRENRISVWLLAYIALATTWPLVGSAVSLFLKRR 163 KCL KLS+ NRIS+WL+AYIA+ T+WPLVG A+ K + Sbjct: 487 KCLEKLSQHNRISMWLMAYIAITTSWPLVGPALQFVFKNK 526 >ref|XP_002266169.1| PREDICTED: embryogenesis-associated protein EMB8-like [Vitis vinifera] Length = 571 Score = 57.8 bits (138), Expect = 2e-06 Identities = 24/40 (60%), Positives = 31/40 (77%) Frame = -1 Query: 282 KCLNKLSRENRISVWLLAYIALATTWPLVGSAVSLFLKRR 163 KCL KLS+ NRIS+WL+AYIA+ T+WPLVG A+ K + Sbjct: 520 KCLEKLSQHNRISMWLMAYIAITTSWPLVGPALQFVFKNK 559 >emb|CBI29717.3| unnamed protein product [Vitis vinifera] Length = 545 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/46 (54%), Positives = 36/46 (78%) Frame = -1 Query: 300 IVTPVVKCLNKLSRENRISVWLLAYIALATTWPLVGSAVSLFLKRR 163 + PV + +++LSR +R S+WLL YIA+ TTWPLVGSA+ L LK++ Sbjct: 488 VTAPVKRRMDQLSRYSRKSIWLLVYIAIVTTWPLVGSALLLTLKKK 533 >ref|XP_002263770.1| PREDICTED: embryogenesis-associated protein EMB8 [Vitis vinifera] Length = 568 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/46 (54%), Positives = 36/46 (78%) Frame = -1 Query: 300 IVTPVVKCLNKLSRENRISVWLLAYIALATTWPLVGSAVSLFLKRR 163 + PV + +++LSR +R S+WLL YIA+ TTWPLVGSA+ L LK++ Sbjct: 511 VTAPVKRRMDQLSRYSRKSIWLLVYIAIVTTWPLVGSALLLTLKKK 556 >emb|CAN63261.1| hypothetical protein VITISV_036938 [Vitis vinifera] Length = 153 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/46 (54%), Positives = 36/46 (78%) Frame = -1 Query: 300 IVTPVVKCLNKLSRENRISVWLLAYIALATTWPLVGSAVSLFLKRR 163 + PV + +++LSR +R S+WLL YIA+ TTWPLVGSA+ L LK++ Sbjct: 96 VTAPVKRRMDQLSRYSRKSIWLLVYIAIVTTWPLVGSALLLTLKKK 141