BLASTX nr result
ID: Mentha25_contig00048392
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00048392 (432 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006340987.1| PREDICTED: mitochondrial substrate carrier f... 82 8e-14 ref|XP_004246399.1| PREDICTED: mitochondrial substrate carrier f... 82 8e-14 gb|EYU26616.1| hypothetical protein MIMGU_mgv1a009595mg [Mimulus... 80 4e-13 gb|EPS61182.1| hypothetical protein M569_13615, partial [Genlise... 79 5e-13 gb|EYU41786.1| hypothetical protein MIMGU_mgv1a009733mg [Mimulus... 79 6e-13 ref|XP_006429213.1| hypothetical protein CICLE_v10012050mg [Citr... 74 3e-11 ref|XP_007026884.1| Mitochondrial substrate carrier family prote... 74 3e-11 ref|XP_006595882.1| PREDICTED: mitochondrial substrate carrier f... 73 4e-11 ref|XP_006486430.1| PREDICTED: mitochondrial substrate carrier f... 73 4e-11 ref|XP_006486429.1| PREDICTED: mitochondrial substrate carrier f... 73 4e-11 ref|XP_006435594.1| hypothetical protein CICLE_v10032001mg [Citr... 73 4e-11 ref|XP_003544163.1| PREDICTED: mitochondrial substrate carrier f... 73 4e-11 ref|XP_002272651.1| PREDICTED: mitochondrial substrate carrier f... 73 4e-11 emb|CAN73411.1| hypothetical protein VITISV_024376 [Vitis vinifera] 73 4e-11 ref|XP_007009174.1| Mitochondrial substrate carrier family prote... 73 5e-11 ref|XP_004490851.1| PREDICTED: mitochondrial substrate carrier f... 73 5e-11 ref|XP_004149948.1| PREDICTED: mitochondrial substrate carrier f... 73 5e-11 ref|XP_002315196.1| mitochondrial substrate carrier family prote... 72 6e-11 ref|XP_006480897.1| PREDICTED: mitochondrial substrate carrier f... 72 8e-11 ref|XP_006850446.1| hypothetical protein AMTR_s00165p00068240 [A... 72 8e-11 >ref|XP_006340987.1| PREDICTED: mitochondrial substrate carrier family protein B-like [Solanum tuberosum] Length = 352 Score = 82.0 bits (201), Expect = 8e-14 Identities = 37/42 (88%), Positives = 40/42 (95%) Frame = -2 Query: 431 RSEGFRGIYRGIMPEYYKVVPGVGIVFMTYETLKKLLAQGPF 306 R+EG RG+YRGIMPEYYKVVP VGIVFMTYETLKKLL+QGPF Sbjct: 309 RTEGLRGLYRGIMPEYYKVVPSVGIVFMTYETLKKLLSQGPF 350 >ref|XP_004246399.1| PREDICTED: mitochondrial substrate carrier family protein B-like [Solanum lycopersicum] Length = 355 Score = 82.0 bits (201), Expect = 8e-14 Identities = 37/42 (88%), Positives = 40/42 (95%) Frame = -2 Query: 431 RSEGFRGIYRGIMPEYYKVVPGVGIVFMTYETLKKLLAQGPF 306 R+EG RG+YRGIMPEYYKVVP VGIVFMTYETLKKLL+QGPF Sbjct: 312 RTEGLRGLYRGIMPEYYKVVPSVGIVFMTYETLKKLLSQGPF 353 >gb|EYU26616.1| hypothetical protein MIMGU_mgv1a009595mg [Mimulus guttatus] Length = 337 Score = 79.7 bits (195), Expect = 4e-13 Identities = 37/43 (86%), Positives = 39/43 (90%) Frame = -2 Query: 431 RSEGFRGIYRGIMPEYYKVVPGVGIVFMTYETLKKLLAQGPFS 303 RSEG RG+YRGIMPEYYKVVP VGIVFMTYETLKKLL+ GP S Sbjct: 294 RSEGLRGLYRGIMPEYYKVVPSVGIVFMTYETLKKLLSNGPSS 336 >gb|EPS61182.1| hypothetical protein M569_13615, partial [Genlisea aurea] Length = 319 Score = 79.3 bits (194), Expect = 5e-13 Identities = 36/42 (85%), Positives = 39/42 (92%) Frame = -2 Query: 431 RSEGFRGIYRGIMPEYYKVVPGVGIVFMTYETLKKLLAQGPF 306 R+EG RG+YRGI+PEYYKVVPGVGIVFMTYETLKKLLA PF Sbjct: 278 RTEGLRGLYRGILPEYYKVVPGVGIVFMTYETLKKLLADRPF 319 >gb|EYU41786.1| hypothetical protein MIMGU_mgv1a009733mg [Mimulus guttatus] Length = 333 Score = 79.0 bits (193), Expect = 6e-13 Identities = 35/41 (85%), Positives = 39/41 (95%) Frame = -2 Query: 431 RSEGFRGIYRGIMPEYYKVVPGVGIVFMTYETLKKLLAQGP 309 RSEGFRG+YRGI+PEYYKVVP VGIVFMTYETLKK+L+ GP Sbjct: 291 RSEGFRGLYRGILPEYYKVVPSVGIVFMTYETLKKVLSNGP 331 >ref|XP_006429213.1| hypothetical protein CICLE_v10012050mg [Citrus clementina] gi|557531270|gb|ESR42453.1| hypothetical protein CICLE_v10012050mg [Citrus clementina] Length = 358 Score = 73.6 bits (179), Expect = 3e-11 Identities = 34/43 (79%), Positives = 38/43 (88%) Frame = -2 Query: 431 RSEGFRGIYRGIMPEYYKVVPGVGIVFMTYETLKKLLAQGPFS 303 +SEG RG+YRGI+PEYYKVVPGVGIVFMTYETLK LL+ P S Sbjct: 315 QSEGLRGLYRGILPEYYKVVPGVGIVFMTYETLKMLLSSVPTS 357 >ref|XP_007026884.1| Mitochondrial substrate carrier family protein [Theobroma cacao] gi|508715489|gb|EOY07386.1| Mitochondrial substrate carrier family protein [Theobroma cacao] Length = 355 Score = 73.6 bits (179), Expect = 3e-11 Identities = 34/43 (79%), Positives = 39/43 (90%) Frame = -2 Query: 431 RSEGFRGIYRGIMPEYYKVVPGVGIVFMTYETLKKLLAQGPFS 303 +SEG RG+YRGI+PEYYKVVPGVGIVFMTYETLK LL++ P S Sbjct: 312 QSEGLRGLYRGILPEYYKVVPGVGIVFMTYETLKMLLSRIPTS 354 >ref|XP_006595882.1| PREDICTED: mitochondrial substrate carrier family protein V-like isoform X2 [Glycine max] Length = 331 Score = 73.2 bits (178), Expect = 4e-11 Identities = 33/38 (86%), Positives = 36/38 (94%) Frame = -2 Query: 431 RSEGFRGIYRGIMPEYYKVVPGVGIVFMTYETLKKLLA 318 R+EGFRG+YRGI+PEYYKVVPGVGI FMTYETLK LLA Sbjct: 289 RTEGFRGLYRGILPEYYKVVPGVGICFMTYETLKMLLA 326 >ref|XP_006486430.1| PREDICTED: mitochondrial substrate carrier family protein B-like isoform X2 [Citrus sinensis] gi|568866164|ref|XP_006486431.1| PREDICTED: mitochondrial substrate carrier family protein B-like isoform X3 [Citrus sinensis] Length = 344 Score = 73.2 bits (178), Expect = 4e-11 Identities = 33/38 (86%), Positives = 36/38 (94%) Frame = -2 Query: 431 RSEGFRGIYRGIMPEYYKVVPGVGIVFMTYETLKKLLA 318 R+EGFRG+YRGI+PEYYKVVPGVGI FMTYETLK LLA Sbjct: 303 RTEGFRGLYRGILPEYYKVVPGVGICFMTYETLKMLLA 340 >ref|XP_006486429.1| PREDICTED: mitochondrial substrate carrier family protein B-like isoform X1 [Citrus sinensis] Length = 346 Score = 73.2 bits (178), Expect = 4e-11 Identities = 33/38 (86%), Positives = 36/38 (94%) Frame = -2 Query: 431 RSEGFRGIYRGIMPEYYKVVPGVGIVFMTYETLKKLLA 318 R+EGFRG+YRGI+PEYYKVVPGVGI FMTYETLK LLA Sbjct: 305 RTEGFRGLYRGILPEYYKVVPGVGICFMTYETLKMLLA 342 >ref|XP_006435594.1| hypothetical protein CICLE_v10032001mg [Citrus clementina] gi|557537790|gb|ESR48834.1| hypothetical protein CICLE_v10032001mg [Citrus clementina] Length = 344 Score = 73.2 bits (178), Expect = 4e-11 Identities = 33/38 (86%), Positives = 36/38 (94%) Frame = -2 Query: 431 RSEGFRGIYRGIMPEYYKVVPGVGIVFMTYETLKKLLA 318 R+EGFRG+YRGI+PEYYKVVPGVGI FMTYETLK LLA Sbjct: 303 RTEGFRGLYRGILPEYYKVVPGVGICFMTYETLKMLLA 340 >ref|XP_003544163.1| PREDICTED: mitochondrial substrate carrier family protein V-like isoform X1 [Glycine max] Length = 326 Score = 73.2 bits (178), Expect = 4e-11 Identities = 33/38 (86%), Positives = 36/38 (94%) Frame = -2 Query: 431 RSEGFRGIYRGIMPEYYKVVPGVGIVFMTYETLKKLLA 318 R+EGFRG+YRGI+PEYYKVVPGVGI FMTYETLK LLA Sbjct: 284 RTEGFRGLYRGILPEYYKVVPGVGICFMTYETLKMLLA 321 >ref|XP_002272651.1| PREDICTED: mitochondrial substrate carrier family protein B [Vitis vinifera] gi|297740295|emb|CBI30477.3| unnamed protein product [Vitis vinifera] Length = 336 Score = 73.2 bits (178), Expect = 4e-11 Identities = 32/39 (82%), Positives = 37/39 (94%) Frame = -2 Query: 431 RSEGFRGIYRGIMPEYYKVVPGVGIVFMTYETLKKLLAQ 315 RSEG RG+YRGI+PEYYKVVPGVGI FMTYETLK++L+Q Sbjct: 294 RSEGLRGLYRGILPEYYKVVPGVGIAFMTYETLKRVLSQ 332 >emb|CAN73411.1| hypothetical protein VITISV_024376 [Vitis vinifera] Length = 331 Score = 73.2 bits (178), Expect = 4e-11 Identities = 32/39 (82%), Positives = 37/39 (94%) Frame = -2 Query: 431 RSEGFRGIYRGIMPEYYKVVPGVGIVFMTYETLKKLLAQ 315 RSEG RG+YRGI+PEYYKVVPGVGI FMTYETLK++L+Q Sbjct: 289 RSEGLRGLYRGILPEYYKVVPGVGIAFMTYETLKRVLSQ 327 >ref|XP_007009174.1| Mitochondrial substrate carrier family protein isoform 1 [Theobroma cacao] gi|508726087|gb|EOY17984.1| Mitochondrial substrate carrier family protein isoform 1 [Theobroma cacao] Length = 345 Score = 72.8 bits (177), Expect = 5e-11 Identities = 33/38 (86%), Positives = 36/38 (94%) Frame = -2 Query: 431 RSEGFRGIYRGIMPEYYKVVPGVGIVFMTYETLKKLLA 318 R+EGFRG+YRGI+PEYYKVVPGVGI FMTYETLK LLA Sbjct: 302 RTEGFRGLYRGIVPEYYKVVPGVGICFMTYETLKMLLA 339 >ref|XP_004490851.1| PREDICTED: mitochondrial substrate carrier family protein B-like isoform X1 [Cicer arietinum] Length = 327 Score = 72.8 bits (177), Expect = 5e-11 Identities = 32/39 (82%), Positives = 37/39 (94%) Frame = -2 Query: 431 RSEGFRGIYRGIMPEYYKVVPGVGIVFMTYETLKKLLAQ 315 R+EGFRG+YRGI+PEYYKVVPGVGI FMTYETLK +LA+ Sbjct: 285 RTEGFRGLYRGILPEYYKVVPGVGICFMTYETLKMVLAE 323 >ref|XP_004149948.1| PREDICTED: mitochondrial substrate carrier family protein B-like [Cucumis sativus] gi|449513191|ref|XP_004164257.1| PREDICTED: mitochondrial substrate carrier family protein B-like [Cucumis sativus] Length = 348 Score = 72.8 bits (177), Expect = 5e-11 Identities = 33/38 (86%), Positives = 35/38 (92%) Frame = -2 Query: 431 RSEGFRGIYRGIMPEYYKVVPGVGIVFMTYETLKKLLA 318 R+EGFRG YRGI+PEYYKVVPGVGI FMTYETLK LLA Sbjct: 305 RTEGFRGFYRGILPEYYKVVPGVGICFMTYETLKSLLA 342 >ref|XP_002315196.1| mitochondrial substrate carrier family protein [Populus trichocarpa] gi|222864236|gb|EEF01367.1| mitochondrial substrate carrier family protein [Populus trichocarpa] Length = 337 Score = 72.4 bits (176), Expect = 6e-11 Identities = 33/38 (86%), Positives = 36/38 (94%) Frame = -2 Query: 431 RSEGFRGIYRGIMPEYYKVVPGVGIVFMTYETLKKLLA 318 ++EGFRG+YRGIMPEYYKVVPGVGI FMTYETLK LLA Sbjct: 294 QTEGFRGLYRGIMPEYYKVVPGVGICFMTYETLKLLLA 331 >ref|XP_006480897.1| PREDICTED: mitochondrial substrate carrier family protein B-like [Citrus sinensis] Length = 358 Score = 72.0 bits (175), Expect = 8e-11 Identities = 33/43 (76%), Positives = 38/43 (88%) Frame = -2 Query: 431 RSEGFRGIYRGIMPEYYKVVPGVGIVFMTYETLKKLLAQGPFS 303 +SEG +G+YRGI+PEYYKVVPGVGIVFMTYETLK LL+ P S Sbjct: 315 QSEGLQGLYRGILPEYYKVVPGVGIVFMTYETLKMLLSSVPTS 357 >ref|XP_006850446.1| hypothetical protein AMTR_s00165p00068240 [Amborella trichopoda] gi|548854091|gb|ERN12027.1| hypothetical protein AMTR_s00165p00068240 [Amborella trichopoda] Length = 366 Score = 72.0 bits (175), Expect = 8e-11 Identities = 32/41 (78%), Positives = 36/41 (87%) Frame = -2 Query: 431 RSEGFRGIYRGIMPEYYKVVPGVGIVFMTYETLKKLLAQGP 309 R+EG RG+YRGI+PEYYKVVP VGIVFMTYETLK LL+ P Sbjct: 323 RTEGLRGLYRGILPEYYKVVPSVGIVFMTYETLKMLLSDAP 363