BLASTX nr result
ID: Mentha25_contig00048389
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00048389 (309 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU21940.1| hypothetical protein MIMGU_mgv1a002905mg [Mimulus... 68 1e-09 ref|XP_002324275.2| hypothetical protein POPTR_0018s01290g [Popu... 59 7e-07 ref|XP_004245215.1| PREDICTED: carbon catabolite repressor prote... 57 2e-06 >gb|EYU21940.1| hypothetical protein MIMGU_mgv1a002905mg [Mimulus guttatus] Length = 627 Score = 68.2 bits (165), Expect = 1e-09 Identities = 32/38 (84%), Positives = 32/38 (84%) Frame = +1 Query: 1 HVMHQTRGFPTKKWGSDHIALVSEFAFTKDISSEAPKQ 114 HVM QT GFPTKKWGSDHIALVSEFAFTKDIS E Q Sbjct: 590 HVMQQTPGFPTKKWGSDHIALVSEFAFTKDISPENASQ 627 >ref|XP_002324275.2| hypothetical protein POPTR_0018s01290g [Populus trichocarpa] gi|550317779|gb|EEF02840.2| hypothetical protein POPTR_0018s01290g [Populus trichocarpa] Length = 507 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/33 (78%), Positives = 27/33 (81%) Frame = +1 Query: 1 HVMHQTRGFPTKKWGSDHIALVSEFAFTKDISS 99 H M T GFPTKKWGSDHIAL SEFAFTKD S+ Sbjct: 469 HAMQWTAGFPTKKWGSDHIALASEFAFTKDASN 501 >ref|XP_004245215.1| PREDICTED: carbon catabolite repressor protein 4 homolog 6-like [Solanum lycopersicum] Length = 873 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/32 (81%), Positives = 27/32 (84%) Frame = +1 Query: 1 HVMHQTRGFPTKKWGSDHIALVSEFAFTKDIS 96 + M RGFPTKKWGSDHIALVSEFAFT DIS Sbjct: 833 NAMQFVRGFPTKKWGSDHIALVSEFAFTSDIS 864