BLASTX nr result
ID: Mentha25_contig00048382
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00048382 (345 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU21376.1| hypothetical protein MIMGU_mgv1a009903mg [Mimulus... 63 4e-08 >gb|EYU21376.1| hypothetical protein MIMGU_mgv1a009903mg [Mimulus guttatus] Length = 328 Score = 63.2 bits (152), Expect = 4e-08 Identities = 32/70 (45%), Positives = 40/70 (57%) Frame = +3 Query: 135 VKIQSLSASDGEGVARQQKQETGCEPDPGNLARXXXXXXXXXXXXKWDALFSKDEDVDDD 314 VKIQS +D + + E+GC PDP NL R +W+ LFSK ED D+D Sbjct: 66 VKIQSFPVNDDD---EKTAHESGCGPDPDNLTRSLLIEILPSSSPEWNTLFSKSEDFDED 122 Query: 315 PSGKSGSGQE 344 P+ KSGSGQE Sbjct: 123 PAEKSGSGQE 132