BLASTX nr result
ID: Mentha25_contig00048327
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00048327 (376 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001936887.1| conserved hypothetical protein [Pyrenophora ... 64 2e-08 ref|XP_001942376.1| conserved hypothetical protein [Pyrenophora ... 64 2e-08 ref|XP_001941680.1| conserved hypothetical protein [Pyrenophora ... 64 2e-08 gb|EQK97447.1| polyprotein [Ophiocordyceps sinensis CO18] 64 3e-08 ref|XP_001937194.1| conserved hypothetical protein [Pyrenophora ... 64 3e-08 ref|XP_001937183.1| conserved hypothetical protein [Pyrenophora ... 64 3e-08 ref|XP_001937044.1| conserved hypothetical protein [Pyrenophora ... 64 3e-08 ref|XP_001942496.1| conserved hypothetical protein [Pyrenophora ... 64 3e-08 ref|XP_001933845.1| conserved hypothetical protein [Pyrenophora ... 64 3e-08 ref|XP_001939997.1| conserved hypothetical protein [Pyrenophora ... 64 3e-08 ref|XP_001939021.1| conserved hypothetical protein [Pyrenophora ... 64 3e-08 ref|XP_001932438.1| conserved hypothetical protein [Pyrenophora ... 64 3e-08 ref|XP_001932242.1| conserved hypothetical protein [Pyrenophora ... 64 3e-08 ref|XP_001931203.1| conserved hypothetical protein [Pyrenophora ... 64 3e-08 ref|XP_003298889.1| hypothetical protein PTT_09725 [Pyrenophora ... 63 4e-08 gb|EQL00343.1| hypothetical protein OCS_03942 [Ophiocordyceps si... 63 5e-08 gb|EMR86563.1| hypothetical protein BcDW1_4798 [Botryotinia fuck... 61 1e-07 ref|XP_003298190.1| hypothetical protein PTT_08811 [Pyrenophora ... 61 1e-07 ref|XP_001549564.1| hypothetical protein BC1G_11985 [Botryotinia... 61 1e-07 ref|XP_001554590.1| hypothetical protein BC1G_07179 [Botryotinia... 61 1e-07 >ref|XP_001936887.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187983986|gb|EDU49474.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 1380 Score = 63.9 bits (154), Expect = 2e-08 Identities = 29/64 (45%), Positives = 42/64 (65%), Gaps = 1/64 (1%) Frame = -1 Query: 223 KKCFICNKEDCWSTKHSSEERKRAKIQYMVD-AETDDDSYFAQYLAEYEGNELDGYTNEG 47 KKC++C+K CWST H+ EERKR+K QY+ A T + F+ +L YEG E+D + E Sbjct: 431 KKCYVCSKTGCWSTNHTLEERKRSKAQYITHCAITGEQMEFSTFLVAYEGEEVDQFFLEE 490 Query: 46 CEEN 35 +E+ Sbjct: 491 QDED 494 >ref|XP_001942376.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187979575|gb|EDU46201.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 881 Score = 63.9 bits (154), Expect = 2e-08 Identities = 29/64 (45%), Positives = 42/64 (65%), Gaps = 1/64 (1%) Frame = -1 Query: 223 KKCFICNKEDCWSTKHSSEERKRAKIQYMVD-AETDDDSYFAQYLAEYEGNELDGYTNEG 47 KKC++C+K CWST H+ EERKR+K QY+ A T + F+ +L YEG E+D + E Sbjct: 510 KKCYVCSKTGCWSTNHTLEERKRSKAQYITHCAITGEQMEFSTFLVAYEGEEVDQFFLEE 569 Query: 46 CEEN 35 +E+ Sbjct: 570 QDED 573 >ref|XP_001941680.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187977773|gb|EDU44399.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 915 Score = 63.9 bits (154), Expect = 2e-08 Identities = 29/64 (45%), Positives = 42/64 (65%), Gaps = 1/64 (1%) Frame = -1 Query: 223 KKCFICNKEDCWSTKHSSEERKRAKIQYMVD-AETDDDSYFAQYLAEYEGNELDGYTNEG 47 KKC++C+K CWST H+ EERKR+K QY+ A T + F+ +L YEG E+D + E Sbjct: 176 KKCYVCSKTGCWSTNHTLEERKRSKAQYITHCAITGEQMEFSTFLVAYEGEEVDQFFLEE 235 Query: 46 CEEN 35 +E+ Sbjct: 236 QDED 239 >gb|EQK97447.1| polyprotein [Ophiocordyceps sinensis CO18] Length = 522 Score = 63.5 bits (153), Expect = 3e-08 Identities = 30/80 (37%), Positives = 49/80 (61%), Gaps = 2/80 (2%) Frame = -1 Query: 262 NHAQVHDSERSVVKKCFICNKEDCWSTKHSSEERKRAKIQYMVDAETDDDSY--FAQYLA 89 N++Q + R KKCF+C +E CWST+H++EE+++AK Q + F+ Y+ Sbjct: 442 NYSQGYRGSRPWSKKCFVCGEEGCWSTQHTAEEQQKAKAQCLAHCHFASVPLVDFSAYVM 501 Query: 88 EYEGNELDGYTNEGCEENSY 29 YEG+E+DG + EE+S+ Sbjct: 502 AYEGDEMDGPDDWNEEEHSW 521 >ref|XP_001937194.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187984293|gb|EDU49781.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 1214 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/64 (45%), Positives = 41/64 (64%), Gaps = 1/64 (1%) Frame = -1 Query: 223 KKCFICNKEDCWSTKHSSEERKRAKIQYMVD-AETDDDSYFAQYLAEYEGNELDGYTNEG 47 KKC++C K CWST H+ EERKR+K QY+ A T + F+ +L YEG E+D + E Sbjct: 391 KKCYVCGKTGCWSTNHTLEERKRSKAQYITHCAITGEQMEFSTFLVAYEGEEVDQFFLEE 450 Query: 46 CEEN 35 +E+ Sbjct: 451 QDED 454 >ref|XP_001937183.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187984282|gb|EDU49770.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 1396 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/64 (45%), Positives = 41/64 (64%), Gaps = 1/64 (1%) Frame = -1 Query: 223 KKCFICNKEDCWSTKHSSEERKRAKIQYMVD-AETDDDSYFAQYLAEYEGNELDGYTNEG 47 KKC++C K CWST H+ EERKR+K QY+ A T + F+ +L YEG E+D + E Sbjct: 236 KKCYVCGKTGCWSTNHTLEERKRSKAQYITHCAITGEQMEFSTFLVAYEGEEVDQFFLEE 295 Query: 46 CEEN 35 +E+ Sbjct: 296 QDED 299 >ref|XP_001937044.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187984143|gb|EDU49631.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 1079 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/64 (45%), Positives = 41/64 (64%), Gaps = 1/64 (1%) Frame = -1 Query: 223 KKCFICNKEDCWSTKHSSEERKRAKIQYMVD-AETDDDSYFAQYLAEYEGNELDGYTNEG 47 KKC++C K CWST H+ EERKR+K QY+ A T + F+ +L YEG E+D + E Sbjct: 431 KKCYVCGKTGCWSTNHTLEERKRSKAQYITHCAITGEQMEFSTFLVAYEGEEVDQFFLEE 490 Query: 46 CEEN 35 +E+ Sbjct: 491 QDED 494 >ref|XP_001942496.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187982720|gb|EDU48208.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|308525071|gb|ADO33889.1| polyprotein [Pyrenophora tritici-repentis] gi|545289850|gb|AGW27431.1| polyprotein [Pyrenophora tritici-repentis] Length = 1716 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/64 (45%), Positives = 41/64 (64%), Gaps = 1/64 (1%) Frame = -1 Query: 223 KKCFICNKEDCWSTKHSSEERKRAKIQYMVD-AETDDDSYFAQYLAEYEGNELDGYTNEG 47 KKC++C K CWST H+ EERKR+K QY+ A T + F+ +L YEG E+D + E Sbjct: 556 KKCYVCGKTGCWSTNHTLEERKRSKAQYITHCAITGEQMEFSTFLVAYEGEEVDQFFLEE 615 Query: 46 CEEN 35 +E+ Sbjct: 616 QDED 619 >ref|XP_001933845.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187979724|gb|EDU46350.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 1520 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/64 (45%), Positives = 41/64 (64%), Gaps = 1/64 (1%) Frame = -1 Query: 223 KKCFICNKEDCWSTKHSSEERKRAKIQYMVD-AETDDDSYFAQYLAEYEGNELDGYTNEG 47 KKC++C K CWST H+ EERKR+K QY+ A T + F+ +L YEG E+D + E Sbjct: 556 KKCYVCGKTGCWSTNHTLEERKRSKAQYITHCAITGEQMEFSTFLVAYEGEEVDQFFLEE 615 Query: 46 CEEN 35 +E+ Sbjct: 616 QDED 619 >ref|XP_001939997.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187976090|gb|EDU42716.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 1619 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/64 (45%), Positives = 41/64 (64%), Gaps = 1/64 (1%) Frame = -1 Query: 223 KKCFICNKEDCWSTKHSSEERKRAKIQYMVD-AETDDDSYFAQYLAEYEGNELDGYTNEG 47 KKC++C K CWST H+ EERKR+K QY+ A T + F+ +L YEG E+D + E Sbjct: 556 KKCYVCGKTGCWSTNHTLEERKRSKAQYITHCAITGEQMEFSTFLVAYEGEEVDQFFLEE 615 Query: 46 CEEN 35 +E+ Sbjct: 616 QDED 619 >ref|XP_001939021.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187975114|gb|EDU41740.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 1665 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/64 (45%), Positives = 41/64 (64%), Gaps = 1/64 (1%) Frame = -1 Query: 223 KKCFICNKEDCWSTKHSSEERKRAKIQYMVD-AETDDDSYFAQYLAEYEGNELDGYTNEG 47 KKC++C K CWST H+ EERKR+K QY+ A T + F+ +L YEG E+D + E Sbjct: 738 KKCYVCGKTGCWSTNHTLEERKRSKAQYITHCAITGEQMEFSTFLVAYEGEEVDQFFLEE 797 Query: 46 CEEN 35 +E+ Sbjct: 798 QDED 801 >ref|XP_001932438.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187974044|gb|EDU41543.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 1569 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/64 (45%), Positives = 41/64 (64%), Gaps = 1/64 (1%) Frame = -1 Query: 223 KKCFICNKEDCWSTKHSSEERKRAKIQYMVD-AETDDDSYFAQYLAEYEGNELDGYTNEG 47 KKC++C K CWST H+ EERKR+K QY+ A T + F+ +L YEG E+D + E Sbjct: 431 KKCYVCGKTGCWSTNHTLEERKRSKAQYITHCAITGEQMEFSTFLVAYEGEEVDQFFLEE 490 Query: 46 CEEN 35 +E+ Sbjct: 491 QDED 494 >ref|XP_001932242.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187973848|gb|EDU41347.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 1452 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/64 (45%), Positives = 41/64 (64%), Gaps = 1/64 (1%) Frame = -1 Query: 223 KKCFICNKEDCWSTKHSSEERKRAKIQYMVD-AETDDDSYFAQYLAEYEGNELDGYTNEG 47 KKC++C K CWST H+ EERKR+K QY+ A T + F+ +L YEG E+D + E Sbjct: 391 KKCYVCGKTGCWSTNHTLEERKRSKAQYITHCAITGEQMEFSTFLVAYEGEEVDQFFLEE 450 Query: 46 CEEN 35 +E+ Sbjct: 451 QDED 454 >ref|XP_001931203.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|189203571|ref|XP_001938121.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|189208860|ref|XP_001940763.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187972809|gb|EDU40308.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187976856|gb|EDU43482.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187985220|gb|EDU50708.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 1591 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/64 (45%), Positives = 41/64 (64%), Gaps = 1/64 (1%) Frame = -1 Query: 223 KKCFICNKEDCWSTKHSSEERKRAKIQYMVD-AETDDDSYFAQYLAEYEGNELDGYTNEG 47 KKC++C K CWST H+ EERKR+K QY+ A T + F+ +L YEG E+D + E Sbjct: 431 KKCYVCGKTGCWSTNHTLEERKRSKAQYITHCAITGEQMEFSTFLVAYEGEEVDQFFLEE 490 Query: 46 CEEN 35 +E+ Sbjct: 491 QDED 494 >ref|XP_003298889.1| hypothetical protein PTT_09725 [Pyrenophora teres f. teres 0-1] gi|311327715|gb|EFQ93015.1| hypothetical protein PTT_09725 [Pyrenophora teres f. teres 0-1] Length = 446 Score = 63.2 bits (152), Expect = 4e-08 Identities = 36/76 (47%), Positives = 46/76 (60%), Gaps = 7/76 (9%) Frame = -1 Query: 223 KKCFICNKEDCWSTKHSSEERKRAKIQYM-----VDAETDDDSYFAQYLAEYEGNE-LDG 62 KKCF+C KE CWST H+ EERK A+ Q++ DA+ D F+ YLAEYEG E + Sbjct: 198 KKCFVCQKEGCWSTNHTDEERKAARAQFVSACRFADAQPPAD--FSVYLAEYEGIEHVIQ 255 Query: 61 YTNEGC-EENSYHTLD 17 Y +G EE +Y D Sbjct: 256 YNQQGWREEETYEDED 271 >gb|EQL00343.1| hypothetical protein OCS_03942 [Ophiocordyceps sinensis CO18] Length = 295 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/52 (53%), Positives = 35/52 (67%), Gaps = 1/52 (1%) Frame = -1 Query: 223 KKCFICNKEDCWSTKHSSEERKRAKIQYMVDA-ETDDDSYFAQYLAEYEGNE 71 KKCF+C KE CWST+H+ EER R+K QY T + S F YL +YEG+E Sbjct: 97 KKCFVCQKEGCWSTRHTPEERARSKAQYHAQCLLTGNPSTFEAYLTDYEGDE 148 >gb|EMR86563.1| hypothetical protein BcDW1_4798 [Botryotinia fuckeliana BcDW1] Length = 1839 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/55 (50%), Positives = 34/55 (61%), Gaps = 2/55 (3%) Frame = -1 Query: 223 KKCFICNKEDCWSTKHSSEER--KRAKIQYMVDAETDDDSYFAQYLAEYEGNELD 65 KKCF+C KEDCWST+HS EER R+K + + D F Q+L EYEG D Sbjct: 608 KKCFVCRKEDCWSTRHSKEERDESRSKYKEQFKDRNNFDKSFEQFLVEYEGPNQD 662 >ref|XP_003298190.1| hypothetical protein PTT_08811 [Pyrenophora teres f. teres 0-1] gi|311328773|gb|EFQ93714.1| hypothetical protein PTT_08811 [Pyrenophora teres f. teres 0-1] Length = 173 Score = 61.2 bits (147), Expect = 1e-07 Identities = 26/67 (38%), Positives = 45/67 (67%), Gaps = 1/67 (1%) Frame = -1 Query: 244 DSERSVVKKCFICNKEDCWSTKHSSEERKRAKIQYMVDAETDDDSY-FAQYLAEYEGNEL 68 +++R KKC++CNK CWST+HS EERK A+ +Y +T + + + +LA++EG ++ Sbjct: 9 NTQRRNNKKCYVCNKPGCWSTRHSREERKEAQQRYRTHVQTHNVNIDYEAFLAQFEGIDI 68 Query: 67 DGYTNEG 47 D ++G Sbjct: 69 DNDDDDG 75 >ref|XP_001549564.1| hypothetical protein BC1G_11985 [Botryotinia fuckeliana B05.10] Length = 1759 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/55 (50%), Positives = 34/55 (61%), Gaps = 2/55 (3%) Frame = -1 Query: 223 KKCFICNKEDCWSTKHSSEER--KRAKIQYMVDAETDDDSYFAQYLAEYEGNELD 65 KKCF+C KEDCWST+HS EER R+K + + D F Q+L EYEG D Sbjct: 608 KKCFVCRKEDCWSTRHSKEERDESRSKYKEQFKDRNNFDKSFEQFLVEYEGPNQD 662 >ref|XP_001554590.1| hypothetical protein BC1G_07179 [Botryotinia fuckeliana B05.10] Length = 1839 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/55 (50%), Positives = 34/55 (61%), Gaps = 2/55 (3%) Frame = -1 Query: 223 KKCFICNKEDCWSTKHSSEER--KRAKIQYMVDAETDDDSYFAQYLAEYEGNELD 65 KKCF+C KEDCWST+HS EER R+K + + D F Q+L EYEG D Sbjct: 608 KKCFVCRKEDCWSTRHSKEERDESRSKYKEQFKDRNNFDKSFEQFLVEYEGPNQD 662