BLASTX nr result
ID: Mentha25_contig00048009
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00048009 (359 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU17674.1| hypothetical protein MIMGU_mgv1a011723mg [Mimulus... 110 2e-22 ref|XP_002277244.1| PREDICTED: histidine biosynthesis bifunction... 83 3e-14 ref|XP_004248357.1| PREDICTED: histidine biosynthesis bifunction... 80 4e-13 ref|XP_004493104.1| PREDICTED: histidine biosynthesis bifunction... 72 6e-11 ref|XP_004493105.1| PREDICTED: histidine biosynthesis bifunction... 72 8e-11 ref|XP_004302491.1| PREDICTED: histidine biosynthesis bifunction... 71 2e-10 gb|AFW79537.1| histidine biosynthesis protein hisIE [Zea mays] 71 2e-10 ref|NP_001150567.1| histidine biosynthesis bifunctional protein ... 71 2e-10 ref|XP_007032053.1| Histidine biosynthesis bifunctional protein ... 70 3e-10 ref|XP_006305506.1| hypothetical protein CARUB_v10009971mg [Caps... 70 3e-10 ref|NP_174469.1| histidine biosynthesis bifunctional protein his... 69 5e-10 ref|XP_002893693.1| AT-IE [Arabidopsis lyrata subsp. lyrata] gi|... 69 5e-10 ref|XP_006415287.1| hypothetical protein EUTSA_v10008417mg [Eutr... 69 7e-10 ref|XP_004309896.1| PREDICTED: histidine biosynthesis bifunction... 69 9e-10 ref|XP_006470873.1| PREDICTED: histidine biosynthesis bifunction... 68 1e-09 ref|XP_006370154.1| Histidine biosynthesis bifunctional protein ... 68 1e-09 ref|XP_002443519.1| hypothetical protein SORBIDRAFT_08g020870 [S... 68 1e-09 ref|XP_002457646.1| hypothetical protein SORBIDRAFT_03g011110 [S... 68 1e-09 gb|EMT23487.1| Histidine biosynthesis bifunctional protein hisIE... 68 2e-09 ref|XP_007205670.1| hypothetical protein PRUPE_ppa009521mg [Prun... 68 2e-09 >gb|EYU17674.1| hypothetical protein MIMGU_mgv1a011723mg [Mimulus guttatus] Length = 272 Score = 110 bits (276), Expect = 2e-22 Identities = 58/82 (70%), Positives = 65/82 (79%) Frame = +2 Query: 113 MAVPYANYFQLPKVNPKCHLFSSSSGPSTRVAPAYSCLSSGPAFHLEAKVDPLLDSVKWD 292 MAVPY+N FQ+PK+N K LFSSS+G TR SS A HL+AKVDPLLDSVKWD Sbjct: 1 MAVPYSNCFQIPKINSKSLLFSSSNGICTRA-------SSVKALHLDAKVDPLLDSVKWD 53 Query: 293 DKGLAVAIAQNVDTGAVLMQGF 358 DKGLAVAIAQNV+TGA+LMQGF Sbjct: 54 DKGLAVAIAQNVNTGAILMQGF 75 >ref|XP_002277244.1| PREDICTED: histidine biosynthesis bifunctional protein hisIE, chloroplastic [Vitis vinifera] gi|296082253|emb|CBI21258.3| unnamed protein product [Vitis vinifera] Length = 289 Score = 83.2 bits (204), Expect = 3e-14 Identities = 49/89 (55%), Positives = 59/89 (66%), Gaps = 7/89 (7%) Frame = +2 Query: 113 MAVPYANYFQLPKVNPKCHLFSSSSG--PSTRVAPAYSCLSSGPA-----FHLEAKVDPL 271 MAV Y++ Q +V P+ LF S+ R+ +YS +S+ LEAKV+ L Sbjct: 1 MAVSYSHCLQSLRVTPRTRLFVSNVDCWRDNRIMKSYSPVSASSKKPHQDLSLEAKVETL 60 Query: 272 LDSVKWDDKGLAVAIAQNVDTGAVLMQGF 358 LDSVKWDDKGLAVAIAQNVDTGAVLMQGF Sbjct: 61 LDSVKWDDKGLAVAIAQNVDTGAVLMQGF 89 >ref|XP_004248357.1| PREDICTED: histidine biosynthesis bifunctional protein hisIE, chloroplastic-like [Solanum lycopersicum] Length = 280 Score = 79.7 bits (195), Expect = 4e-13 Identities = 48/83 (57%), Positives = 54/83 (65%), Gaps = 1/83 (1%) Frame = +2 Query: 113 MAVPYANYFQLPKVNPKCHLFSSSSGPSTRVAPAYSCLS-SGPAFHLEAKVDPLLDSVKW 289 M+V Y+ FQ KV P + SS + A +C+ S LEAKVD LLD VKW Sbjct: 1 MSVSYSPCFQPLKVFPTSNRIRSSGALTLNRRNAVACMKKSHEDTSLEAKVDFLLDHVKW 60 Query: 290 DDKGLAVAIAQNVDTGAVLMQGF 358 DDKGLAVAIAQNVDTGAVLMQGF Sbjct: 61 DDKGLAVAIAQNVDTGAVLMQGF 83 >ref|XP_004493104.1| PREDICTED: histidine biosynthesis bifunctional protein hisIE, chloroplastic-like isoform X1 [Cicer arietinum] Length = 309 Score = 72.4 bits (176), Expect = 6e-11 Identities = 41/83 (49%), Positives = 51/83 (61%) Frame = +2 Query: 110 AMAVPYANYFQLPKVNPKCHLFSSSSGPSTRVAPAYSCLSSGPAFHLEAKVDPLLDSVKW 289 +MA+ Y + Q KC+L SS G + + L+ + KVD LLD +KW Sbjct: 25 SMAISYVHMLQSAGGFQKCNLSFSSHGYPKSSSRTHH-LAFASMHTSDPKVDSLLDGIKW 83 Query: 290 DDKGLAVAIAQNVDTGAVLMQGF 358 DDKGLAVAIAQNVDTGA+LMQGF Sbjct: 84 DDKGLAVAIAQNVDTGAILMQGF 106 >ref|XP_004493105.1| PREDICTED: histidine biosynthesis bifunctional protein hisIE, chloroplastic-like isoform X2 [Cicer arietinum] Length = 284 Score = 72.0 bits (175), Expect = 8e-11 Identities = 41/82 (50%), Positives = 50/82 (60%) Frame = +2 Query: 113 MAVPYANYFQLPKVNPKCHLFSSSSGPSTRVAPAYSCLSSGPAFHLEAKVDPLLDSVKWD 292 MA+ Y + Q KC+L SS G + + L+ + KVD LLD +KWD Sbjct: 1 MAISYVHMLQSAGGFQKCNLSFSSHGYPKSSSRTHH-LAFASMHTSDPKVDSLLDGIKWD 59 Query: 293 DKGLAVAIAQNVDTGAVLMQGF 358 DKGLAVAIAQNVDTGA+LMQGF Sbjct: 60 DKGLAVAIAQNVDTGAILMQGF 81 >ref|XP_004302491.1| PREDICTED: histidine biosynthesis bifunctional protein hisIE, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 287 Score = 70.9 bits (172), Expect = 2e-10 Identities = 32/38 (84%), Positives = 37/38 (97%) Frame = +2 Query: 245 HLEAKVDPLLDSVKWDDKGLAVAIAQNVDTGAVLMQGF 358 HL++KV+ +LDSVKWDDKGLAVAIAQNVDTGA+LMQGF Sbjct: 51 HLQSKVETVLDSVKWDDKGLAVAIAQNVDTGAILMQGF 88 >gb|AFW79537.1| histidine biosynthesis protein hisIE [Zea mays] Length = 299 Score = 70.9 bits (172), Expect = 2e-10 Identities = 37/55 (67%), Positives = 42/55 (76%), Gaps = 5/55 (9%) Frame = +2 Query: 209 PAYSCLSSGP-----AFHLEAKVDPLLDSVKWDDKGLAVAIAQNVDTGAVLMQGF 358 PA S +SS P A ++ +VD LLDSVKWD KGLAVAIAQNVDTGA+LMQGF Sbjct: 47 PAVSVVSSSPQSVAGAITVDTEVDTLLDSVKWDSKGLAVAIAQNVDTGAILMQGF 101 >ref|NP_001150567.1| histidine biosynthesis bifunctional protein hisIE [Zea mays] gi|195640256|gb|ACG39596.1| histidine biosynthesis bifunctional protein hisIE [Zea mays] Length = 299 Score = 70.9 bits (172), Expect = 2e-10 Identities = 37/55 (67%), Positives = 42/55 (76%), Gaps = 5/55 (9%) Frame = +2 Query: 209 PAYSCLSSGP-----AFHLEAKVDPLLDSVKWDDKGLAVAIAQNVDTGAVLMQGF 358 PA S +SS P A ++ +VD LLDSVKWD KGLAVAIAQNVDTGA+LMQGF Sbjct: 47 PAVSVVSSSPQSVPGAITVDTEVDTLLDSVKWDSKGLAVAIAQNVDTGAILMQGF 101 >ref|XP_007032053.1| Histidine biosynthesis bifunctional protein [Theobroma cacao] gi|508711082|gb|EOY02979.1| Histidine biosynthesis bifunctional protein [Theobroma cacao] Length = 370 Score = 70.1 bits (170), Expect = 3e-10 Identities = 32/37 (86%), Positives = 36/37 (97%) Frame = +2 Query: 248 LEAKVDPLLDSVKWDDKGLAVAIAQNVDTGAVLMQGF 358 L++KVD LLDS+KWDDKGLAVAIAQNVDTGA+LMQGF Sbjct: 53 LQSKVDTLLDSIKWDDKGLAVAIAQNVDTGAILMQGF 89 >ref|XP_006305506.1| hypothetical protein CARUB_v10009971mg [Capsella rubella] gi|482574217|gb|EOA38404.1| hypothetical protein CARUB_v10009971mg [Capsella rubella] Length = 278 Score = 70.1 bits (170), Expect = 3e-10 Identities = 33/37 (89%), Positives = 36/37 (97%) Frame = +2 Query: 248 LEAKVDPLLDSVKWDDKGLAVAIAQNVDTGAVLMQGF 358 L++KVD LLDS+KWDDKGLAVAIAQNVDTGAVLMQGF Sbjct: 45 LQSKVDNLLDSIKWDDKGLAVAIAQNVDTGAVLMQGF 81 >ref|NP_174469.1| histidine biosynthesis bifunctional protein hisIE [Arabidopsis thaliana] gi|11132859|sp|O82768.1|HIS2_ARATH RecName: Full=Histidine biosynthesis bifunctional protein hisIE, chloroplastic; AltName: Full=Protein HISTIDINE BIOSYNTHESIS 2; Includes: RecName: Full=Phosphoribosyl-AMP cyclohydrolase; Short=PRA-CH; Includes: RecName: Full=Phosphoribosyl-ATP pyrophosphatase; Short=PRA-PH; Flags: Precursor gi|12321304|gb|AAG50725.1|AC079041_18 phosphoribosyl-ATP pyrophosphohydrolase (At-IE) [Arabidopsis thaliana] gi|3461884|dbj|BAA32528.1| phosphoribosyl-ATP pyrophosphohydrolase [Arabidopsis thaliana] gi|3461886|dbj|BAA32529.1| phosphoribosyl-ATP pyrophosphohydrolase [Arabidopsis thaliana] gi|15028395|gb|AAK76674.1| putative phosphoribosyl-ATP pyrophosphohydrolase At-IE [Arabidopsis thaliana] gi|19310753|gb|AAL85107.1| putative phosphoribosyl-ATP pyrophosphohydrolase At-IE [Arabidopsis thaliana] gi|21554409|gb|AAM63514.1| phosphoribosyl-ATP pyrophosphohydrolase At-IE [Arabidopsis thaliana] gi|332193287|gb|AEE31408.1| histidine biosynthesis bifunctional protein hisIE [Arabidopsis thaliana] Length = 281 Score = 69.3 bits (168), Expect = 5e-10 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = +2 Query: 248 LEAKVDPLLDSVKWDDKGLAVAIAQNVDTGAVLMQGF 358 L+AKVD LLD +KWDDKGLAVAIAQNVDTGAVLMQGF Sbjct: 48 LQAKVDNLLDRIKWDDKGLAVAIAQNVDTGAVLMQGF 84 >ref|XP_002893693.1| AT-IE [Arabidopsis lyrata subsp. lyrata] gi|297339535|gb|EFH69952.1| AT-IE [Arabidopsis lyrata subsp. lyrata] Length = 281 Score = 69.3 bits (168), Expect = 5e-10 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = +2 Query: 248 LEAKVDPLLDSVKWDDKGLAVAIAQNVDTGAVLMQGF 358 L+AKVD LLD +KWDDKGLAVAIAQNVDTGAVLMQGF Sbjct: 48 LQAKVDNLLDRIKWDDKGLAVAIAQNVDTGAVLMQGF 84 >ref|XP_006415287.1| hypothetical protein EUTSA_v10008417mg [Eutrema salsugineum] gi|557093058|gb|ESQ33640.1| hypothetical protein EUTSA_v10008417mg [Eutrema salsugineum] Length = 281 Score = 68.9 bits (167), Expect = 7e-10 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = +2 Query: 248 LEAKVDPLLDSVKWDDKGLAVAIAQNVDTGAVLMQGF 358 L+AKVD LLD +KWDDKGLAVAIAQNVDTGA+LMQGF Sbjct: 48 LQAKVDNLLDRIKWDDKGLAVAIAQNVDTGAILMQGF 84 >ref|XP_004309896.1| PREDICTED: histidine biosynthesis bifunctional protein hisIE, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 288 Score = 68.6 bits (166), Expect = 9e-10 Identities = 30/38 (78%), Positives = 36/38 (94%) Frame = +2 Query: 245 HLEAKVDPLLDSVKWDDKGLAVAIAQNVDTGAVLMQGF 358 H ++KVD +LDS+KWDDKGLAVA+AQNVDTGA+LMQGF Sbjct: 53 HPQSKVDTVLDSIKWDDKGLAVALAQNVDTGAILMQGF 90 >ref|XP_006470873.1| PREDICTED: histidine biosynthesis bifunctional protein hisIE, chloroplastic-like [Citrus sinensis] Length = 278 Score = 68.2 bits (165), Expect = 1e-09 Identities = 32/37 (86%), Positives = 36/37 (97%) Frame = +2 Query: 248 LEAKVDPLLDSVKWDDKGLAVAIAQNVDTGAVLMQGF 358 L++KVD LLDSVKWD+KGLAVAIAQNVDTGA+LMQGF Sbjct: 46 LQSKVDRLLDSVKWDNKGLAVAIAQNVDTGAILMQGF 82 >ref|XP_006370154.1| Histidine biosynthesis bifunctional protein hisIE [Populus trichocarpa] gi|550349333|gb|ERP66723.1| Histidine biosynthesis bifunctional protein hisIE [Populus trichocarpa] Length = 286 Score = 68.2 bits (165), Expect = 1e-09 Identities = 32/43 (74%), Positives = 37/43 (86%) Frame = +2 Query: 230 SGPAFHLEAKVDPLLDSVKWDDKGLAVAIAQNVDTGAVLMQGF 358 S +L++KV+ LLDSVKWDDKGLAV IAQN+DTGAVLMQGF Sbjct: 48 SDKEIYLKSKVETLLDSVKWDDKGLAVGIAQNIDTGAVLMQGF 90 >ref|XP_002443519.1| hypothetical protein SORBIDRAFT_08g020870 [Sorghum bicolor] gi|241944212|gb|EES17357.1| hypothetical protein SORBIDRAFT_08g020870 [Sorghum bicolor] Length = 306 Score = 68.2 bits (165), Expect = 1e-09 Identities = 35/56 (62%), Positives = 41/56 (73%) Frame = +2 Query: 191 PSTRVAPAYSCLSSGPAFHLEAKVDPLLDSVKWDDKGLAVAIAQNVDTGAVLMQGF 358 P+ VA + + G ++ KVD LLDSVKWD KGLAVAIAQNVDTGA+LMQGF Sbjct: 53 PAVSVAAGSAQSAPGAVPVVDPKVDVLLDSVKWDSKGLAVAIAQNVDTGAILMQGF 108 >ref|XP_002457646.1| hypothetical protein SORBIDRAFT_03g011110 [Sorghum bicolor] gi|241929621|gb|EES02766.1| hypothetical protein SORBIDRAFT_03g011110 [Sorghum bicolor] Length = 297 Score = 68.2 bits (165), Expect = 1e-09 Identities = 37/66 (56%), Positives = 44/66 (66%), Gaps = 5/66 (7%) Frame = +2 Query: 176 SSSSGPSTRVAPAYSCLSSGP-----AFHLEAKVDPLLDSVKWDDKGLAVAIAQNVDTGA 340 + +S P R Y +S P A ++ +VD LLDSVKWD KGLAVAIAQNVDTGA Sbjct: 34 AEASAPGWRRREPYPAVSVVPGSAPGAVAVDTEVDTLLDSVKWDSKGLAVAIAQNVDTGA 93 Query: 341 VLMQGF 358 +LMQGF Sbjct: 94 ILMQGF 99 >gb|EMT23487.1| Histidine biosynthesis bifunctional protein hisIE, chloroplastic [Aegilops tauschii] Length = 300 Score = 67.8 bits (164), Expect = 2e-09 Identities = 36/56 (64%), Positives = 42/56 (75%) Frame = +2 Query: 191 PSTRVAPAYSCLSSGPAFHLEAKVDPLLDSVKWDDKGLAVAIAQNVDTGAVLMQGF 358 P +AP S S+ A ++ KV+ LLDSVKWD KGLAVAIAQNVDTGA+LMQGF Sbjct: 46 PVLSIAPG-SARSTPAALAVDPKVEALLDSVKWDVKGLAVAIAQNVDTGAILMQGF 100 >ref|XP_007205670.1| hypothetical protein PRUPE_ppa009521mg [Prunus persica] gi|462401312|gb|EMJ06869.1| hypothetical protein PRUPE_ppa009521mg [Prunus persica] Length = 289 Score = 67.8 bits (164), Expect = 2e-09 Identities = 30/38 (78%), Positives = 37/38 (97%) Frame = +2 Query: 245 HLEAKVDPLLDSVKWDDKGLAVAIAQNVDTGAVLMQGF 358 HL++KV+ +LDSVKWD++GLAVAIAQNVDTGA+LMQGF Sbjct: 53 HLQSKVETVLDSVKWDNRGLAVAIAQNVDTGAILMQGF 90