BLASTX nr result
ID: Mentha25_contig00047951
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00047951 (433 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCU77495.1| mitochondrial 30S ribosomal protein S10 [Blumeri... 94 2e-17 gb|EPQ62294.1| Mitochondrial ribosomal [Blumeria graminis f. sp.... 93 3e-17 ref|XP_007291666.1| ribosomal protein S10p/S20e [Marssonina brun... 91 1e-16 ref|XP_747544.2| 37 ribosomal protein Rsm10 [Aspergillus fumigat... 87 2e-15 ref|XP_001257742.1| mitochondrial 37S ribosomal protein RSM10 [N... 86 4e-15 ref|XP_002153234.1| mitochondrial 37S ribosomal protein RSM10 [T... 84 2e-14 gb|EPS26083.1| hypothetical protein PDE_01019 [Penicillium oxali... 84 2e-14 gb|EON66640.1| hypothetical protein W97_05886 [Coniosporium apol... 84 2e-14 emb|CCF42483.1| ribosomal protein S10p/S20e [Colletotrichum higg... 84 2e-14 ref|XP_002488207.1| tryptophan--tRNA ligase [Talaromyces stipita... 84 3e-14 gb|EYE97289.1| 30S ribosomal protein S10 [Aspergillus ruber CBS ... 83 5e-14 ref|XP_007592839.1| ribosomal protein S10p/S20e [Colletotrichum ... 83 5e-14 gb|ETS75686.1| hypothetical protein PFICI_12630 [Pestalotiopsis ... 83 5e-14 gb|EFQ28681.1| ribosomal protein S10p/S20e [Colletotrichum grami... 82 6e-14 sp|Q5AYZ1.2|RT10_EMENI RecName: Full=37S ribosomal protein S10, ... 82 6e-14 ref|XP_002557333.1| Pc12g04640 [Penicillium chrysogenum Wisconsi... 82 6e-14 ref|XP_664093.1| hypothetical protein AN6489.2 [Aspergillus nidu... 82 6e-14 ref|XP_001214807.1| tryptophan--tRNA ligase [Aspergillus terreus... 82 8e-14 gb|EZF32892.1| ribosomal protein S10 [Trichophyton interdigitale... 82 1e-13 gb|EPE34063.1| Nucleotidylyl transferase [Glarea lozoyensis ATCC... 82 1e-13 >emb|CCU77495.1| mitochondrial 30S ribosomal protein S10 [Blumeria graminis f. sp. hordei DH14] Length = 274 Score = 94.4 bits (233), Expect = 2e-17 Identities = 55/105 (52%), Positives = 65/105 (61%), Gaps = 4/105 (3%) Frame = -2 Query: 303 SYELDERTPSDLSTTKLQTDWESEQNIALEGREIXXXXXXXXXXXNQ----EPRPPRAVQ 136 S+ L ++ S Q+D ES+ + E +E + EPR PRAVQ Sbjct: 26 SFGLKKKEESQTEKMPSQSDTESKNELDREKQEKNNDNSSSEEFDDTFEDPEPRLPRAVQ 85 Query: 135 AAYLRPLRRQPTHNIPVCDLQLRSYSARNLEFMADFALRAAYFLD 1 AAYL PLRR+ T+ IPVCDLQLRSYS RNLEFMAD ALRAAYFLD Sbjct: 86 AAYLGPLRRKVTYGIPVCDLQLRSYSVRNLEFMADVALRAAYFLD 130 >gb|EPQ62294.1| Mitochondrial ribosomal [Blumeria graminis f. sp. tritici 96224] Length = 184 Score = 93.2 bits (230), Expect = 3e-17 Identities = 46/54 (85%), Positives = 48/54 (88%) Frame = -2 Query: 162 EPRPPRAVQAAYLRPLRRQPTHNIPVCDLQLRSYSARNLEFMADFALRAAYFLD 1 EPR PRAVQAAYL PLRR+ T+ IPVCDLQLRSYS RNLEFMAD ALRAAYFLD Sbjct: 77 EPRLPRAVQAAYLGPLRRKVTYGIPVCDLQLRSYSVRNLEFMADVALRAAYFLD 130 >ref|XP_007291666.1| ribosomal protein S10p/S20e [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] gi|406864962|gb|EKD18005.1| ribosomal protein S10p/S20e [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] Length = 340 Score = 91.3 bits (225), Expect = 1e-16 Identities = 43/51 (84%), Positives = 46/51 (90%) Frame = -2 Query: 156 RPPRAVQAAYLRPLRRQPTHNIPVCDLQLRSYSARNLEFMADFALRAAYFL 4 R PRAVQAAYLRPLRRQPT+ +P CDLQLRSYS RNLEF ADFALRAAY+L Sbjct: 153 RLPRAVQAAYLRPLRRQPTYGVPTCDLQLRSYSIRNLEFFADFALRAAYYL 203 >ref|XP_747544.2| 37 ribosomal protein Rsm10 [Aspergillus fumigatus Af293] gi|129556230|gb|EAL85506.2| 37 ribosomal protein Rsm10, putative [Aspergillus fumigatus Af293] gi|159122330|gb|EDP47451.1| conserved hypothetical protein [Aspergillus fumigatus A1163] Length = 217 Score = 87.4 bits (215), Expect = 2e-15 Identities = 41/55 (74%), Positives = 47/55 (85%) Frame = -2 Query: 165 QEPRPPRAVQAAYLRPLRRQPTHNIPVCDLQLRSYSARNLEFMADFALRAAYFLD 1 Q+ R PR+VQA YLRPLRR+P +PVCDLQLRSYS RNLEF ADFALRAAY+L+ Sbjct: 27 QKARLPRSVQALYLRPLRRKPEFGLPVCDLQLRSYSVRNLEFFADFALRAAYYLE 81 >ref|XP_001257742.1| mitochondrial 37S ribosomal protein RSM10 [Neosartorya fischeri NRRL 181] gi|119405894|gb|EAW15845.1| ribosomal protein S10p/S20e, putative [Neosartorya fischeri NRRL 181] Length = 217 Score = 86.3 bits (212), Expect = 4e-15 Identities = 40/55 (72%), Positives = 47/55 (85%) Frame = -2 Query: 165 QEPRPPRAVQAAYLRPLRRQPTHNIPVCDLQLRSYSARNLEFMADFALRAAYFLD 1 Q+ R PR+VQA YLRPLRR+P +PVCDLQLRSYS RNLEF ADFA+RAAY+L+ Sbjct: 27 QKARLPRSVQALYLRPLRRKPEFGLPVCDLQLRSYSVRNLEFFADFAVRAAYYLE 81 >ref|XP_002153234.1| mitochondrial 37S ribosomal protein RSM10 [Talaromyces marneffei ATCC 18224] gi|210064754|gb|EEA18849.1| 37 ribosomal protein Rsm10, putative [Talaromyces marneffei ATCC 18224] Length = 277 Score = 84.3 bits (207), Expect = 2e-14 Identities = 39/55 (70%), Positives = 46/55 (83%) Frame = -2 Query: 165 QEPRPPRAVQAAYLRPLRRQPTHNIPVCDLQLRSYSARNLEFMADFALRAAYFLD 1 Q R PR+VQA YLRPLRR+ H +PVCDLQLRSYS RN+EF ADFA+RAAY+L+ Sbjct: 87 QGSRLPRSVQALYLRPLRRKAQHGLPVCDLQLRSYSVRNVEFFADFAIRAAYYLN 141 >gb|EPS26083.1| hypothetical protein PDE_01019 [Penicillium oxalicum 114-2] Length = 270 Score = 84.0 bits (206), Expect = 2e-14 Identities = 46/96 (47%), Positives = 57/96 (59%) Frame = -2 Query: 288 ERTPSDLSTTKLQTDWESEQNIALEGREIXXXXXXXXXXXNQEPRPPRAVQAAYLRPLRR 109 E TP+ + T+ T E+ A ++ R PR+VQA YLRPLRR Sbjct: 49 EPTPTSIPTSAASTPVEASSEPA---EPTVKEWSDRLGAIDKHARLPRSVQALYLRPLRR 105 Query: 108 QPTHNIPVCDLQLRSYSARNLEFMADFALRAAYFLD 1 + H +PVCDLQLRSYS NLEF ADFALRAAY+L+ Sbjct: 106 KAEHGLPVCDLQLRSYSVENLEFFADFALRAAYYLN 141 >gb|EON66640.1| hypothetical protein W97_05886 [Coniosporium apollinis CBS 100218] Length = 267 Score = 84.0 bits (206), Expect = 2e-14 Identities = 39/52 (75%), Positives = 44/52 (84%) Frame = -2 Query: 156 RPPRAVQAAYLRPLRRQPTHNIPVCDLQLRSYSARNLEFMADFALRAAYFLD 1 R PR+VQA YLRPLRR H IPVCDLQLR+YS RN+EF ADFALRAAY+L+ Sbjct: 80 RLPRSVQAVYLRPLRRAAQHGIPVCDLQLRTYSVRNMEFFADFALRAAYYLN 131 >emb|CCF42483.1| ribosomal protein S10p/S20e [Colletotrichum higginsianum] Length = 229 Score = 84.0 bits (206), Expect = 2e-14 Identities = 39/53 (73%), Positives = 45/53 (84%) Frame = -2 Query: 162 EPRPPRAVQAAYLRPLRRQPTHNIPVCDLQLRSYSARNLEFMADFALRAAYFL 4 EPR PR++QA YL+PLRR+ + IP CDLQLRSYS RNLEF ADFALRAAY+L Sbjct: 14 EPRYPRSIQALYLQPLRREAEYGIPSCDLQLRSYSLRNLEFFADFALRAAYYL 66 >ref|XP_002488207.1| tryptophan--tRNA ligase [Talaromyces stipitatus ATCC 10500] gi|218713128|gb|EED12553.1| tryptophanyl-tRNA synthetase, putative [Talaromyces stipitatus ATCC 10500] Length = 683 Score = 83.6 bits (205), Expect = 3e-14 Identities = 38/52 (73%), Positives = 45/52 (86%) Frame = -2 Query: 156 RPPRAVQAAYLRPLRRQPTHNIPVCDLQLRSYSARNLEFMADFALRAAYFLD 1 R PR+VQA YLRPLRR+ H +PVCDLQLRSYS RN+EF ADFA+RAAY+L+ Sbjct: 97 RLPRSVQALYLRPLRRKAQHGLPVCDLQLRSYSVRNVEFFADFAIRAAYYLN 148 >gb|EYE97289.1| 30S ribosomal protein S10 [Aspergillus ruber CBS 135680] Length = 261 Score = 82.8 bits (203), Expect = 5e-14 Identities = 49/105 (46%), Positives = 62/105 (59%) Frame = -2 Query: 318 KDFKNSYELDERTPSDLSTTKLQTDWESEQNIALEGREIXXXXXXXXXXXNQEPRPPRAV 139 + F +S E D DLS ++++ N E E NQ R PR+V Sbjct: 24 RSFASSNEPDV----DLSQSEVRHAASLSGNQGTEQSEYIKPWAKRLDDLNQGARLPRSV 79 Query: 138 QAAYLRPLRRQPTHNIPVCDLQLRSYSARNLEFMADFALRAAYFL 4 QA YLRPLRR+ + +PVCDLQLRSYS RN+EF ADFA+RAAY+L Sbjct: 80 QALYLRPLRRKAQYGLPVCDLQLRSYSVRNVEFFADFAIRAAYYL 124 >ref|XP_007592839.1| ribosomal protein S10p/S20e [Colletotrichum fioriniae PJ7] gi|588903433|gb|EXF83531.1| ribosomal protein S10p/S20e [Colletotrichum fioriniae PJ7] Length = 282 Score = 82.8 bits (203), Expect = 5e-14 Identities = 39/53 (73%), Positives = 44/53 (83%) Frame = -2 Query: 162 EPRPPRAVQAAYLRPLRRQPTHNIPVCDLQLRSYSARNLEFMADFALRAAYFL 4 EPR PR VQA YL+PLRR+ + IP CDLQLRSYS RNLEF +DFALRAAY+L Sbjct: 73 EPRYPRGVQALYLQPLRREAEYGIPSCDLQLRSYSLRNLEFFSDFALRAAYYL 125 >gb|ETS75686.1| hypothetical protein PFICI_12630 [Pestalotiopsis fici W106-1] Length = 198 Score = 82.8 bits (203), Expect = 5e-14 Identities = 39/51 (76%), Positives = 42/51 (82%) Frame = -2 Query: 156 RPPRAVQAAYLRPLRRQPTHNIPVCDLQLRSYSARNLEFMADFALRAAYFL 4 R PRAVQA YLRPLRR PT+ +P CDLQLRSYS NLEF DFALRAAY+L Sbjct: 18 RLPRAVQAVYLRPLRRTPTYGVPSCDLQLRSYSVPNLEFFCDFALRAAYYL 68 >gb|EFQ28681.1| ribosomal protein S10p/S20e [Colletotrichum graminicola M1.001] Length = 272 Score = 82.4 bits (202), Expect = 6e-14 Identities = 39/52 (75%), Positives = 44/52 (84%) Frame = -2 Query: 159 PRPPRAVQAAYLRPLRRQPTHNIPVCDLQLRSYSARNLEFMADFALRAAYFL 4 PR PR+VQA YL+PLRR+ + IP CDLQLRSYS RNLEF ADFALRAAY+L Sbjct: 59 PRYPRSVQALYLQPLRREAEYGIPSCDLQLRSYSLRNLEFFADFALRAAYYL 110 >sp|Q5AYZ1.2|RT10_EMENI RecName: Full=37S ribosomal protein S10, mitochondrial; AltName: Full=Mitochondrial ribosomal small subunit protein 10; Flags: Precursor gi|259480054|tpe|CBF70837.1| TPA: 30S ribosomal protein S10, mitochondrial Precursor (Mitochondrial ribosomal small subunit protein 10) [Source:UniProtKB/Swiss-Prot;Acc:Q5AYZ1] [Aspergillus nidulans FGSC A4] Length = 287 Score = 82.4 bits (202), Expect = 6e-14 Identities = 38/52 (73%), Positives = 45/52 (86%) Frame = -2 Query: 156 RPPRAVQAAYLRPLRRQPTHNIPVCDLQLRSYSARNLEFMADFALRAAYFLD 1 R PR+VQA YLRPLRR+ + +PVCDLQLRSYS RNLEF ADFA+RAAY+L+ Sbjct: 99 RLPRSVQALYLRPLRRKAEYGLPVCDLQLRSYSVRNLEFFADFAIRAAYYLN 150 >ref|XP_002557333.1| Pc12g04640 [Penicillium chrysogenum Wisconsin 54-1255] gi|211581952|emb|CAP80091.1| Pc12g04640 [Penicillium chrysogenum Wisconsin 54-1255] Length = 385 Score = 82.4 bits (202), Expect = 6e-14 Identities = 37/55 (67%), Positives = 47/55 (85%) Frame = -2 Query: 165 QEPRPPRAVQAAYLRPLRRQPTHNIPVCDLQLRSYSARNLEFMADFALRAAYFLD 1 ++ R PR+VQA YLRPLRR+ + +PVCDLQLRSYS RN+EF ADFA+RAAY+L+ Sbjct: 166 EDSRLPRSVQAIYLRPLRRKAEYGLPVCDLQLRSYSVRNVEFFADFAIRAAYYLN 220 >ref|XP_664093.1| hypothetical protein AN6489.2 [Aspergillus nidulans FGSC A4] gi|40738639|gb|EAA57829.1| hypothetical protein AN6489.2 [Aspergillus nidulans FGSC A4] Length = 272 Score = 82.4 bits (202), Expect = 6e-14 Identities = 38/52 (73%), Positives = 45/52 (86%) Frame = -2 Query: 156 RPPRAVQAAYLRPLRRQPTHNIPVCDLQLRSYSARNLEFMADFALRAAYFLD 1 R PR+VQA YLRPLRR+ + +PVCDLQLRSYS RNLEF ADFA+RAAY+L+ Sbjct: 84 RLPRSVQALYLRPLRRKAEYGLPVCDLQLRSYSVRNLEFFADFAIRAAYYLN 135 >ref|XP_001214807.1| tryptophan--tRNA ligase [Aspergillus terreus NIH2624] gi|114191690|gb|EAU33390.1| 30S ribosomal protein S10, mitochondrial precursor [Aspergillus terreus NIH2624] Length = 562 Score = 82.0 bits (201), Expect = 8e-14 Identities = 37/54 (68%), Positives = 46/54 (85%) Frame = -2 Query: 165 QEPRPPRAVQAAYLRPLRRQPTHNIPVCDLQLRSYSARNLEFMADFALRAAYFL 4 Q+ R PR+VQA Y+RPLRR+ + +PVCDLQLRSYS RN+EF ADFA+RAAY+L Sbjct: 33 QKTRLPRSVQAIYMRPLRRKAEYGLPVCDLQLRSYSVRNVEFFADFAIRAAYYL 86 >gb|EZF32892.1| ribosomal protein S10 [Trichophyton interdigitale H6] Length = 296 Score = 81.6 bits (200), Expect = 1e-13 Identities = 36/52 (69%), Positives = 48/52 (92%) Frame = -2 Query: 156 RPPRAVQAAYLRPLRRQPTHNIPVCDLQLRSYSARNLEFMADFALRAAYFLD 1 R P+AVQAAY++PL+R+P + +PVC+LQLRSYSAR++EF ADFALRAAY+L+ Sbjct: 109 RLPKAVQAAYMKPLKRKPEYGLPVCNLQLRSYSARHVEFFADFALRAAYYLN 160 >gb|EPE34063.1| Nucleotidylyl transferase [Glarea lozoyensis ATCC 20868] Length = 643 Score = 81.6 bits (200), Expect = 1e-13 Identities = 37/54 (68%), Positives = 43/54 (79%) Frame = -2 Query: 165 QEPRPPRAVQAAYLRPLRRQPTHNIPVCDLQLRSYSARNLEFMADFALRAAYFL 4 + PR PRAVQA YLRPLRR+ + +P CDLQLRSY+ RNLE ADF LRAAY+L Sbjct: 110 EPPRLPRAVQAVYLRPLRREAKYGVPTCDLQLRSYNVRNLELFADFCLRAAYYL 163