BLASTX nr result
ID: Mentha25_contig00047887
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00047887 (313 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU29322.1| hypothetical protein MIMGU_mgv1a001523mg [Mimulus... 77 2e-12 gb|EPS59026.1| hypothetical protein M569_15785 [Genlisea aurea] 65 1e-08 >gb|EYU29322.1| hypothetical protein MIMGU_mgv1a001523mg [Mimulus guttatus] Length = 803 Score = 77.4 bits (189), Expect = 2e-12 Identities = 38/51 (74%), Positives = 41/51 (80%) Frame = +1 Query: 82 MSKVKHFLRKLHIGDHNHHGRPPALDPSHQAAPPPQQLASTSPSSEVPPTA 234 MSKVKHFLRKLHIGDH HHGRPPA+DP APPPQ L STSP ++P TA Sbjct: 1 MSKVKHFLRKLHIGDH-HHGRPPAVDP-EPPAPPPQPLTSTSPPPDLPETA 49 >gb|EPS59026.1| hypothetical protein M569_15785 [Genlisea aurea] Length = 520 Score = 65.1 bits (157), Expect = 1e-08 Identities = 33/49 (67%), Positives = 37/49 (75%) Frame = +1 Query: 82 MSKVKHFLRKLHIGDHNHHGRPPALDPSHQAAPPPQQLASTSPSSEVPP 228 MSKVKH LRKLHIGDH HHGR ALD S Q++ QQ STSPS ++PP Sbjct: 1 MSKVKHLLRKLHIGDHQHHGRASALDASAQSS-SLQQSNSTSPSFDLPP 48