BLASTX nr result
ID: Mentha25_contig00047771
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00047771 (495 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPE31648.1| hypothetical protein GLAREA_12404 [Glarea lozoyen... 73 5e-11 ref|XP_007296140.1| pre-rRNA processing protein [Marssonina brun... 65 1e-08 gb|ELR10404.1| hypothetical protein GMDG_00816 [Pseudogymnoascus... 65 1e-08 emb|CCU77366.1| pre-rRNA processing protein [Blumeria graminis f... 63 4e-08 ref|XP_001560908.1| hypothetical protein BC1G_00937 [Botryotinia... 63 5e-08 ref|XP_001598136.1| hypothetical protein SS1G_00222 [Sclerotinia... 62 6e-08 gb|ESZ99424.1| hypothetical protein SBOR_0186 [Sclerotinia borea... 62 8e-08 gb|EPQ67669.1| hypothetical protein BGT96224_5331 [Blumeria gram... 61 2e-07 gb|EON61669.1| hypothetical protein W97_00885 [Coniosporium apol... 60 4e-07 ref|XP_007298306.1| DUF947-domain-containing protein [Stereum hi... 60 4e-07 gb|EYB27440.1| hypothetical protein FG05_07399 [Fusarium gramine... 59 5e-07 ref|XP_387575.1| hypothetical protein FG07399.1 [Fusarium gramin... 59 5e-07 gb|EWG47858.1| hypothetical protein FVEG_07858 [Fusarium vertici... 59 9e-07 gb|EKJ70365.1| hypothetical protein FPSE_09359 [Fusarium pseudog... 59 9e-07 ref|XP_007601119.1| hypothetical protein CFIO01_07575 [Colletotr... 57 3e-06 gb|EGY18024.1| rRNA processing protein [Verticillium dahliae VdL... 56 4e-06 gb|EGN98382.1| hypothetical protein SERLA73DRAFT_183354 [Serpula... 56 4e-06 gb|EFQ28097.1| hypothetical protein GLRG_03241 [Colletotrichum g... 56 4e-06 ref|XP_003008386.1| rRNA processing protein [Verticillium alfalf... 56 4e-06 emb|CCE30043.1| related to PITSLRE protein kinase isoforms [Clav... 56 6e-06 >gb|EPE31648.1| hypothetical protein GLAREA_12404 [Glarea lozoyensis ATCC 20868] Length = 296 Score = 72.8 bits (177), Expect = 5e-11 Identities = 36/74 (48%), Positives = 50/74 (67%), Gaps = 3/74 (4%) Frame = +3 Query: 276 NPSHKSARRSDSEDPT---TGLGIVEEKRRRNVKAEFHRSSSHAPAEMSSKRAVTRRRDV 446 NP K + +D ++PT T +E K R +F+RSS HAP E+SSK+AV+RRR+V Sbjct: 84 NPKSKKKKTTDPQEPTDTWTNAESLERKAGRQDHRDFNRSSKHAPTEISSKKAVSRRREV 143 Query: 447 VPIAKRQPRDPRFE 488 VP+ KR+ RDPRF+ Sbjct: 144 VPVPKREFRDPRFD 157 >ref|XP_007296140.1| pre-rRNA processing protein [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] gi|406860475|gb|EKD13533.1| pre-rRNA processing protein [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] Length = 296 Score = 65.1 bits (157), Expect = 1e-08 Identities = 33/75 (44%), Positives = 44/75 (58%) Frame = +3 Query: 264 QSNLNPSHKSARRSDSEDPTTGLGIVEEKRRRNVKAEFHRSSSHAPAEMSSKRAVTRRRD 443 Q++L P K + D E K R +F+RSS HAP E+SSK+AV+R+R+ Sbjct: 84 QASLEPGKKKRLATSEADTWENNEAKERKAGRQDHRDFNRSSKHAPTEISSKKAVSRKRE 143 Query: 444 VVPIAKRQPRDPRFE 488 V+P KR RDPRFE Sbjct: 144 VIPTVKRAYRDPRFE 158 >gb|ELR10404.1| hypothetical protein GMDG_00816 [Pseudogymnoascus destructans 20631-21] Length = 310 Score = 64.7 bits (156), Expect = 1e-08 Identities = 31/61 (50%), Positives = 41/61 (67%) Frame = +3 Query: 309 SEDPTTGLGIVEEKRRRNVKAEFHRSSSHAPAEMSSKRAVTRRRDVVPIAKRQPRDPRFE 488 S+DP E K R +F RS+ +AP E+SSK+AV+R+RDVVP+ KR RDPRF+ Sbjct: 110 SDDPWENNEAAERKAGRKDHRDFSRSNKNAPTEISSKKAVSRKRDVVPVIKRDYRDPRFD 169 Query: 489 P 491 P Sbjct: 170 P 170 >emb|CCU77366.1| pre-rRNA processing protein [Blumeria graminis f. sp. hordei DH14] Length = 288 Score = 63.2 bits (152), Expect = 4e-08 Identities = 32/68 (47%), Positives = 42/68 (61%) Frame = +3 Query: 288 KSARRSDSEDPTTGLGIVEEKRRRNVKAEFHRSSSHAPAEMSSKRAVTRRRDVVPIAKRQ 467 K +S +E P + ++ +AE R + HAP E+SSK+AVTRRRDVV R+ Sbjct: 84 KKITKSSNEQPDHEEEVRRGTSDKSHQAELSRPNKHAPTEVSSKKAVTRRRDVVATVYRK 143 Query: 468 PRDPRFEP 491 PRDPRFEP Sbjct: 144 PRDPRFEP 151 >ref|XP_001560908.1| hypothetical protein BC1G_00937 [Botryotinia fuckeliana B05.10] gi|306755954|sp|A6RKG5.1|RRP36_BOTFB RecName: Full=rRNA biogenesis protein rrp36; AltName: Full=Ribosomal RNA-processing protein 36 gi|472239997|gb|EMR84780.1| putative rrna processing protein [Botryotinia fuckeliana BcDW1] Length = 300 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/50 (58%), Positives = 39/50 (78%) Frame = +3 Query: 342 EEKRRRNVKAEFHRSSSHAPAEMSSKRAVTRRRDVVPIAKRQPRDPRFEP 491 E K + + +F RSS +AP E+SSK+AV+RRR+VVP+ KR+ RDPRFEP Sbjct: 114 ERKAGKKDQRDFTRSSKNAPTEVSSKKAVSRRREVVPVKKREIRDPRFEP 163 >ref|XP_001598136.1| hypothetical protein SS1G_00222 [Sclerotinia sclerotiorum 1980] gi|306755982|sp|A7E4K0.1|RRP36_SCLS1 RecName: Full=rRNA biogenesis protein rrp36; AltName: Full=Ribosomal RNA-processing protein 36 gi|154691084|gb|EDN90822.1| hypothetical protein SS1G_00222 [Sclerotinia sclerotiorum 1980 UF-70] Length = 301 Score = 62.4 bits (150), Expect = 6e-08 Identities = 32/73 (43%), Positives = 48/73 (65%), Gaps = 2/73 (2%) Frame = +3 Query: 279 PSHKSARRS--DSEDPTTGLGIVEEKRRRNVKAEFHRSSSHAPAEMSSKRAVTRRRDVVP 452 PS + +++S + D E K + + +F RSS +AP E+SSK+AV+RRR+VVP Sbjct: 92 PSKRDSKKSKKSNADGWEDNEATERKAGKKDQRDFTRSSKNAPTEISSKKAVSRRREVVP 151 Query: 453 IAKRQPRDPRFEP 491 + KR+ RDPRF+P Sbjct: 152 VKKREIRDPRFDP 164 >gb|ESZ99424.1| hypothetical protein SBOR_0186 [Sclerotinia borealis F-4157] Length = 300 Score = 62.0 bits (149), Expect = 8e-08 Identities = 34/73 (46%), Positives = 46/73 (63%), Gaps = 2/73 (2%) Frame = +3 Query: 279 PSHKSARRS--DSEDPTTGLGIVEEKRRRNVKAEFHRSSSHAPAEMSSKRAVTRRRDVVP 452 PS K +++S S D E K + + +F RSS +APAE+SSK+AV+RRR+ V Sbjct: 91 PSQKDSKKSKKSSGDGWEDNEATERKAGKKDQRDFTRSSKNAPAEISSKKAVSRRREAVL 150 Query: 453 IAKRQPRDPRFEP 491 + KR RDPRFEP Sbjct: 151 VKKRDTRDPRFEP 163 >gb|EPQ67669.1| hypothetical protein BGT96224_5331 [Blumeria graminis f. sp. tritici 96224] Length = 288 Score = 60.8 bits (146), Expect = 2e-07 Identities = 32/53 (60%), Positives = 39/53 (73%), Gaps = 4/53 (7%) Frame = +3 Query: 342 EEKRR----RNVKAEFHRSSSHAPAEMSSKRAVTRRRDVVPIAKRQPRDPRFE 488 EE RR ++ +AE R + HAP E+SSK+AVTRRRDVV A R+PRDPRFE Sbjct: 98 EEVRRGTSEKSHQAELSRPNKHAPTEVSSKKAVTRRRDVVATAYRKPRDPRFE 150 >gb|EON61669.1| hypothetical protein W97_00885 [Coniosporium apollinis CBS 100218] Length = 347 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/43 (62%), Positives = 34/43 (79%) Frame = +3 Query: 366 KAEFHRSSSHAPAEMSSKRAVTRRRDVVPIAKRQPRDPRFEPL 494 K + RSS HAPA+ SSKRAVTRRR V+P+ + + RDPRF+PL Sbjct: 168 KFKHSRSSKHAPAQQSSKRAVTRRRTVIPVHEHKARDPRFDPL 210 >ref|XP_007298306.1| DUF947-domain-containing protein [Stereum hirsutum FP-91666 SS1] gi|389751447|gb|EIM92520.1| DUF947-domain-containing protein [Stereum hirsutum FP-91666 SS1] Length = 363 Score = 59.7 bits (143), Expect = 4e-07 Identities = 32/69 (46%), Positives = 45/69 (65%), Gaps = 5/69 (7%) Frame = +3 Query: 303 SDSEDPTTGL-----GIVEEKRRRNVKAEFHRSSSHAPAEMSSKRAVTRRRDVVPIAKRQ 467 S+ E+PT+ G +E++ ++ K RSS HAP E++SKR V+RRR VV + K + Sbjct: 109 SEPEEPTSRWSREEKGKAKEEKPKSKKDITKRSSKHAPTEVTSKRPVSRRRTVVEVPKME 168 Query: 468 PRDPRFEPL 494 PRDPRF PL Sbjct: 169 PRDPRFLPL 177 >gb|EYB27440.1| hypothetical protein FG05_07399 [Fusarium graminearum] Length = 314 Score = 59.3 bits (142), Expect = 5e-07 Identities = 29/69 (42%), Positives = 42/69 (60%) Frame = +3 Query: 288 KSARRSDSEDPTTGLGIVEEKRRRNVKAEFHRSSSHAPAEMSSKRAVTRRRDVVPIAKRQ 467 K+ + +D + P T + R + RSS HAP E +SK+ V+RRR+++P KRQ Sbjct: 108 KNKKSTDEDTPKTETPAPRKPTRSKDDPKPKRSSKHAPQEQTSKKPVSRRREIIPENKRQ 167 Query: 468 PRDPRFEPL 494 RDPRF+PL Sbjct: 168 YRDPRFDPL 176 >ref|XP_387575.1| hypothetical protein FG07399.1 [Fusarium graminearum PH-1] gi|558863577|gb|ESU13660.1| hypothetical protein FGSG_07399 [Fusarium graminearum PH-1] Length = 314 Score = 59.3 bits (142), Expect = 5e-07 Identities = 29/69 (42%), Positives = 42/69 (60%) Frame = +3 Query: 288 KSARRSDSEDPTTGLGIVEEKRRRNVKAEFHRSSSHAPAEMSSKRAVTRRRDVVPIAKRQ 467 K+ + +D + P T + R + RSS HAP E +SK+ V+RRR+++P KRQ Sbjct: 108 KNKKSTDEDTPKTETPAPRKPTRSKDDPKPKRSSKHAPQEQTSKKPVSRRREIIPENKRQ 167 Query: 468 PRDPRFEPL 494 RDPRF+PL Sbjct: 168 YRDPRFDPL 176 >gb|EWG47858.1| hypothetical protein FVEG_07858 [Fusarium verticillioides 7600] Length = 314 Score = 58.5 bits (140), Expect = 9e-07 Identities = 29/69 (42%), Positives = 42/69 (60%) Frame = +3 Query: 288 KSARRSDSEDPTTGLGIVEEKRRRNVKAEFHRSSSHAPAEMSSKRAVTRRRDVVPIAKRQ 467 KS + +D E P T + + + RSS HAP E +SK+ V+RRR+++P +RQ Sbjct: 107 KSKKSADEEAPKTETPAPRKSTKSKDDPKPKRSSKHAPQEQTSKKPVSRRREILPDNRRQ 166 Query: 468 PRDPRFEPL 494 RDPRF+PL Sbjct: 167 YRDPRFDPL 175 >gb|EKJ70365.1| hypothetical protein FPSE_09359 [Fusarium pseudograminearum CS3096] Length = 308 Score = 58.5 bits (140), Expect = 9e-07 Identities = 29/69 (42%), Positives = 42/69 (60%) Frame = +3 Query: 288 KSARRSDSEDPTTGLGIVEEKRRRNVKAEFHRSSSHAPAEMSSKRAVTRRRDVVPIAKRQ 467 K+ + +D + P T + R + RSS HAP E +SK+ V+RRR+++P KRQ Sbjct: 102 KNKKSTDEDTPKTETPAPRKPTRSKDDPKPKRSSKHAPQEQTSKKPVSRRREILPENKRQ 161 Query: 468 PRDPRFEPL 494 RDPRF+PL Sbjct: 162 YRDPRFDPL 170 >ref|XP_007601119.1| hypothetical protein CFIO01_07575 [Colletotrichum fioriniae PJ7] gi|588893038|gb|EXF75252.1| hypothetical protein CFIO01_07575 [Colletotrichum fioriniae PJ7] Length = 302 Score = 56.6 bits (135), Expect = 3e-06 Identities = 33/76 (43%), Positives = 45/76 (59%), Gaps = 4/76 (5%) Frame = +3 Query: 279 PSHKSARR--SDSEDPTTGLGIVEEKRRRNVKAEFH--RSSSHAPAEMSSKRAVTRRRDV 446 PS K +R S SED + EE R+ H RSS HAP E SSK+ V+RRR++ Sbjct: 90 PSAKRRKRGASPSEDDDSSDSGPEEVGRKPKHGADHVKRSSKHAPMEQSSKKPVSRRREI 149 Query: 447 VPIAKRQPRDPRFEPL 494 + + K + RDPRF+P+ Sbjct: 150 IAVPKMEVRDPRFDPM 165 >gb|EGY18024.1| rRNA processing protein [Verticillium dahliae VdLs.17] Length = 299 Score = 56.2 bits (134), Expect = 4e-06 Identities = 29/68 (42%), Positives = 40/68 (58%) Frame = +3 Query: 288 KSARRSDSEDPTTGLGIVEEKRRRNVKAEFHRSSSHAPAEMSSKRAVTRRRDVVPIAKRQ 467 +SA +SE +G E + R RSS HAP EMSSKR V+R+R++ + K + Sbjct: 93 ESAESEESEIDDSGSDSGNESKYRKRGGLAKRSSKHAPTEMSSKRPVSRKREIFQVPKVE 152 Query: 468 PRDPRFEP 491 RDPRF+P Sbjct: 153 ARDPRFDP 160 >gb|EGN98382.1| hypothetical protein SERLA73DRAFT_183354 [Serpula lacrymans var. lacrymans S7.3] Length = 354 Score = 56.2 bits (134), Expect = 4e-06 Identities = 33/81 (40%), Positives = 44/81 (54%), Gaps = 13/81 (16%) Frame = +3 Query: 291 SARRSDSEDPTTGLGIVEEKR-------------RRNVKAEFHRSSSHAPAEMSSKRAVT 431 S+ DS+ P + GI E + +R+ K R++ HAP E++SKR VT Sbjct: 91 SSSEDDSDGPPSEGGIAETSQFSKSRDKPDQDVPKRSRKDVAKRANKHAPMEVTSKRPVT 150 Query: 432 RRRDVVPIAKRQPRDPRFEPL 494 RRR VV + QPRDPRF PL Sbjct: 151 RRRTVVAVQTAQPRDPRFLPL 171 >gb|EFQ28097.1| hypothetical protein GLRG_03241 [Colletotrichum graminicola M1.001] Length = 304 Score = 56.2 bits (134), Expect = 4e-06 Identities = 34/82 (41%), Positives = 50/82 (60%), Gaps = 5/82 (6%) Frame = +3 Query: 264 QSNLNPSHKSARR----SDSEDPTTGLGIVEEKRRRNVKAEF-HRSSSHAPAEMSSKRAV 428 Q+++ S++ +R SDSE + G E R+ N A R+S HAP E SSK+ V Sbjct: 87 QASMPASNRRRKRGVEPSDSESDSDS-GPEEVGRKPNYNAHTAKRTSKHAPTEQSSKKPV 145 Query: 429 TRRRDVVPIAKRQPRDPRFEPL 494 +RRR+V+ + K + RDPRF+PL Sbjct: 146 SRRREVIAVPKMEVRDPRFDPL 167 >ref|XP_003008386.1| rRNA processing protein [Verticillium alfalfae VaMs.102] gi|306755988|sp|C9S8J9.1|RRP36_VERA1 RecName: Full=rRNA biogenesis protein RRP36; AltName: Full=Ribosomal RNA-processing protein 36 gi|261351532|gb|EEY13960.1| rRNA processing protein [Verticillium alfalfae VaMs.102] Length = 299 Score = 56.2 bits (134), Expect = 4e-06 Identities = 29/68 (42%), Positives = 40/68 (58%) Frame = +3 Query: 288 KSARRSDSEDPTTGLGIVEEKRRRNVKAEFHRSSSHAPAEMSSKRAVTRRRDVVPIAKRQ 467 +SA +SE +G E + R RSS HAP EMSSKR V+R+R++ + K + Sbjct: 93 ESAESEESEIDDSGSDSGNESKYRKRGGLAKRSSKHAPTEMSSKRPVSRKREIFQVPKVE 152 Query: 468 PRDPRFEP 491 RDPRF+P Sbjct: 153 ARDPRFDP 160 >emb|CCE30043.1| related to PITSLRE protein kinase isoforms [Claviceps purpurea 20.1] Length = 297 Score = 55.8 bits (133), Expect = 6e-06 Identities = 29/77 (37%), Positives = 44/77 (57%) Frame = +3 Query: 264 QSNLNPSHKSARRSDSEDPTTGLGIVEEKRRRNVKAEFHRSSSHAPAEMSSKRAVTRRRD 443 Q++L K++ ++ E PTT + + RSS HAP E +SKR V R R+ Sbjct: 86 QASLPTKSKTSAQTPEETPTTNRFSSSLLAKSSKPPAPKRSSKHAPQEQTSKRPVKRLRE 145 Query: 444 VVPIAKRQPRDPRFEPL 494 ++P +R+ RDPRF+PL Sbjct: 146 IIPDPRRKARDPRFDPL 162