BLASTX nr result
ID: Mentha25_contig00047563
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00047563 (373 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002480775.1| reverse transcriptase, putative [Talaromyces... 64 2e-08 ref|XP_002485032.1| conserved hypothetical protein [Talaromyces ... 63 5e-08 ref|XP_002488432.1| reverse transcriptase, putative [Talaromyces... 63 5e-08 ref|XP_002150715.1| reverse transcriptase, putative [Talaromyces... 57 3e-07 ref|XP_002341005.1| reverse transcriptase, putative [Talaromyces... 60 3e-07 ref|XP_002478715.1| hypothetical protein TSTA_089910 [Talaromyce... 60 3e-07 ref|XP_002478709.1| reverse transcriptase, putative [Talaromyces... 60 3e-07 ref|XP_002480777.1| reverse transcriptase, putative [Talaromyces... 60 3e-07 ref|XP_002482386.1| hypothetical protein TSTA_121370 [Talaromyce... 60 3e-07 ref|XP_002488430.1| reverse transcriptase, putative [Talaromyces... 60 3e-07 ref|XP_002488423.1| reverse transcriptase, putative [Talaromyces... 60 3e-07 ref|XP_002488422.1| reverse transcriptase, putative [Talaromyces... 60 3e-07 ref|XP_002482398.1| reverse transcriptase, putative [Talaromyces... 59 5e-07 ref|XP_002485040.1| reverse transcriptase, putative [Talaromyces... 59 5e-07 ref|XP_002486420.1| reverse transcriptase, putative [Talaromyces... 58 2e-06 ref|XP_002480767.1| hypothetical protein TSTA_035590 [Talaromyce... 56 5e-06 >ref|XP_002480775.1| reverse transcriptase, putative [Talaromyces stipitatus ATCC 10500] gi|218720922|gb|EED20341.1| reverse transcriptase, putative [Talaromyces stipitatus ATCC 10500] Length = 882 Score = 64.3 bits (155), Expect = 2e-08 Identities = 31/65 (47%), Positives = 44/65 (67%), Gaps = 1/65 (1%) Frame = +3 Query: 168 IVVVRSE-LWAQEHQKLTSSQRRTITGIFRSTPIGIVVKEAELSPAVSLLDNRQRRYAQR 344 ++V R E +WAQ Q L + Q R ITG+F TPIG +++EA L PA +LLD R +Y R Sbjct: 391 VLVARPEKIWAQRFQVLINKQARAITGMFPKTPIGALIREAALEPATALLDARVAQYTAR 450 Query: 345 IMSLP 359 +++LP Sbjct: 451 LLTLP 455 >ref|XP_002485032.1| conserved hypothetical protein [Talaromyces stipitatus ATCC 10500] gi|218715657|gb|EED15079.1| conserved hypothetical protein [Talaromyces stipitatus ATCC 10500] Length = 550 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/58 (48%), Positives = 40/58 (68%) Frame = +3 Query: 186 ELWAQEHQKLTSSQRRTITGIFRSTPIGIVVKEAELSPAVSLLDNRQRRYAQRIMSLP 359 ++WAQ Q L + Q R ITG+F TPIG +++EA L PA +LLD R +Y R+++LP Sbjct: 36 KIWAQRFQVLINKQARAITGMFPKTPIGALIREAALEPATALLDARVAQYTARLLTLP 93 >ref|XP_002488432.1| reverse transcriptase, putative [Talaromyces stipitatus ATCC 10500] gi|218712250|gb|EED11676.1| reverse transcriptase, putative [Talaromyces stipitatus ATCC 10500] Length = 733 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/58 (48%), Positives = 40/58 (68%) Frame = +3 Query: 186 ELWAQEHQKLTSSQRRTITGIFRSTPIGIVVKEAELSPAVSLLDNRQRRYAQRIMSLP 359 ++WAQ Q L + Q R ITG+F TPIG +++EA L PA +LLD R +Y R+++LP Sbjct: 326 KIWAQRFQVLINKQARAITGMFPKTPIGALIREAALEPATALLDARVAQYTARLLTLP 383 >ref|XP_002150715.1| reverse transcriptase, putative [Talaromyces marneffei ATCC 18224] gi|210068014|gb|EEA22106.1| reverse transcriptase, putative [Talaromyces marneffei ATCC 18224] Length = 992 Score = 57.4 bits (137), Expect(2) = 3e-07 Identities = 27/57 (47%), Positives = 37/57 (64%) Frame = +3 Query: 192 WAQEHQKLTSSQRRTITGIFRSTPIGIVVKEAELSPAVSLLDNRQRRYAQRIMSLPQ 362 WA Q+L +SQ R ITG+ PIG +++EA L PA LLD R+ RY R++ LP+ Sbjct: 539 WALGLQRLVNSQARAITGMLPKAPIGALIREAALEPANVLLDARKARYVTRLLGLPE 595 Score = 22.7 bits (47), Expect(2) = 3e-07 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = +1 Query: 139 VLSVALHEVELWW*GQN 189 V + AL ELWW GQN Sbjct: 521 VQAQALWGSELWWQGQN 537 >ref|XP_002341005.1| reverse transcriptase, putative [Talaromyces stipitatus ATCC 10500] gi|218724201|gb|EED23618.1| reverse transcriptase, putative [Talaromyces stipitatus ATCC 10500] Length = 1091 Score = 60.1 bits (144), Expect = 3e-07 Identities = 29/56 (51%), Positives = 37/56 (66%) Frame = +3 Query: 192 WAQEHQKLTSSQRRTITGIFRSTPIGIVVKEAELSPAVSLLDNRQRRYAQRIMSLP 359 WAQ Q L + Q R ITG+F TPIG +++EA L PA LLD R RY R+++LP Sbjct: 609 WAQRIQILINKQARGITGMFPKTPIGALIREAALEPATVLLDARVARYTARLLALP 664 >ref|XP_002478715.1| hypothetical protein TSTA_089910 [Talaromyces stipitatus ATCC 10500] gi|218722334|gb|EED21752.1| hypothetical protein TSTA_089910 [Talaromyces stipitatus ATCC 10500] Length = 1141 Score = 60.1 bits (144), Expect = 3e-07 Identities = 29/56 (51%), Positives = 37/56 (66%) Frame = +3 Query: 192 WAQEHQKLTSSQRRTITGIFRSTPIGIVVKEAELSPAVSLLDNRQRRYAQRIMSLP 359 WAQ Q L + Q R ITG+F TPIG +++EA L PA LLD R RY R+++LP Sbjct: 805 WAQRIQILINKQARGITGMFPKTPIGALIREAALEPATVLLDARVARYTARLLALP 860 >ref|XP_002478709.1| reverse transcriptase, putative [Talaromyces stipitatus ATCC 10500] gi|218722328|gb|EED21746.1| reverse transcriptase, putative [Talaromyces stipitatus ATCC 10500] Length = 991 Score = 60.1 bits (144), Expect = 3e-07 Identities = 29/56 (51%), Positives = 37/56 (66%) Frame = +3 Query: 192 WAQEHQKLTSSQRRTITGIFRSTPIGIVVKEAELSPAVSLLDNRQRRYAQRIMSLP 359 WAQ Q L + Q R ITG+F TPIG +++EA L PA LLD R RY R+++LP Sbjct: 509 WAQRIQILINKQARGITGMFPKTPIGALIREAALEPATVLLDARVARYTARLLALP 564 >ref|XP_002480777.1| reverse transcriptase, putative [Talaromyces stipitatus ATCC 10500] gi|218720924|gb|EED20343.1| reverse transcriptase, putative [Talaromyces stipitatus ATCC 10500] Length = 1998 Score = 60.1 bits (144), Expect = 3e-07 Identities = 29/56 (51%), Positives = 37/56 (66%) Frame = +3 Query: 192 WAQEHQKLTSSQRRTITGIFRSTPIGIVVKEAELSPAVSLLDNRQRRYAQRIMSLP 359 WAQ Q L + Q R ITG+F TPIG +++EA L PA LLD R RY R+++LP Sbjct: 1516 WAQRIQILINKQARGITGMFPKTPIGALIREAALEPATVLLDARVARYTARLLALP 1571 >ref|XP_002482386.1| hypothetical protein TSTA_121370 [Talaromyces stipitatus ATCC 10500] gi|218718974|gb|EED18394.1| hypothetical protein TSTA_121370 [Talaromyces stipitatus ATCC 10500] Length = 1125 Score = 60.1 bits (144), Expect = 3e-07 Identities = 29/56 (51%), Positives = 37/56 (66%) Frame = +3 Query: 192 WAQEHQKLTSSQRRTITGIFRSTPIGIVVKEAELSPAVSLLDNRQRRYAQRIMSLP 359 WAQ Q L + Q R ITG+F TPIG +++EA L PA LLD R RY R+++LP Sbjct: 643 WAQRIQILINKQARGITGMFPKTPIGALIREAALEPATVLLDARVARYTARLLALP 698 >ref|XP_002488430.1| reverse transcriptase, putative [Talaromyces stipitatus ATCC 10500] gi|218712248|gb|EED11674.1| reverse transcriptase, putative [Talaromyces stipitatus ATCC 10500] Length = 1977 Score = 60.1 bits (144), Expect = 3e-07 Identities = 29/56 (51%), Positives = 37/56 (66%) Frame = +3 Query: 192 WAQEHQKLTSSQRRTITGIFRSTPIGIVVKEAELSPAVSLLDNRQRRYAQRIMSLP 359 WAQ Q L + Q R ITG+F TPIG +++EA L PA LLD R RY R+++LP Sbjct: 1495 WAQRIQILINKQARGITGMFPKTPIGALIREAALEPATVLLDARVARYTARLLALP 1550 >ref|XP_002488423.1| reverse transcriptase, putative [Talaromyces stipitatus ATCC 10500] gi|218712241|gb|EED11667.1| reverse transcriptase, putative [Talaromyces stipitatus ATCC 10500] Length = 1181 Score = 60.1 bits (144), Expect = 3e-07 Identities = 29/56 (51%), Positives = 37/56 (66%) Frame = +3 Query: 192 WAQEHQKLTSSQRRTITGIFRSTPIGIVVKEAELSPAVSLLDNRQRRYAQRIMSLP 359 WAQ Q L + Q R ITG+F TPIG +++EA L PA LLD R RY R+++LP Sbjct: 716 WAQRIQILINKQARGITGMFPKTPIGALIREAALEPATVLLDARVARYTARLLALP 771 >ref|XP_002488422.1| reverse transcriptase, putative [Talaromyces stipitatus ATCC 10500] gi|218712240|gb|EED11666.1| reverse transcriptase, putative [Talaromyces stipitatus ATCC 10500] Length = 1998 Score = 60.1 bits (144), Expect = 3e-07 Identities = 29/56 (51%), Positives = 37/56 (66%) Frame = +3 Query: 192 WAQEHQKLTSSQRRTITGIFRSTPIGIVVKEAELSPAVSLLDNRQRRYAQRIMSLP 359 WAQ Q L + Q R ITG+F TPIG +++EA L PA LLD R RY R+++LP Sbjct: 1516 WAQRIQILINKQARGITGMFPKTPIGALIREAALEPATVLLDARVARYTARLLALP 1571 >ref|XP_002482398.1| reverse transcriptase, putative [Talaromyces stipitatus ATCC 10500] gi|218718986|gb|EED18406.1| reverse transcriptase, putative [Talaromyces stipitatus ATCC 10500] Length = 2069 Score = 59.3 bits (142), Expect = 5e-07 Identities = 28/56 (50%), Positives = 37/56 (66%) Frame = +3 Query: 192 WAQEHQKLTSSQRRTITGIFRSTPIGIVVKEAELSPAVSLLDNRQRRYAQRIMSLP 359 WAQ Q L + Q R ITG+F TPIG +++EA L PA L+D R RY R+++LP Sbjct: 679 WAQRIQILINKQARGITGMFPKTPIGALIREAALEPATVLMDARVARYTARLLALP 734 Score = 59.3 bits (142), Expect = 5e-07 Identities = 28/56 (50%), Positives = 37/56 (66%) Frame = +3 Query: 192 WAQEHQKLTSSQRRTITGIFRSTPIGIVVKEAELSPAVSLLDNRQRRYAQRIMSLP 359 WAQ Q L + Q R ITG+F TPIG +++EA L PA L+D R RY R+++LP Sbjct: 1587 WAQRIQILINKQARGITGMFPKTPIGALIREAALEPATVLMDARVARYTARLLALP 1642 >ref|XP_002485040.1| reverse transcriptase, putative [Talaromyces stipitatus ATCC 10500] gi|218715665|gb|EED15087.1| reverse transcriptase, putative [Talaromyces stipitatus ATCC 10500] Length = 839 Score = 59.3 bits (142), Expect = 5e-07 Identities = 28/56 (50%), Positives = 37/56 (66%) Frame = +3 Query: 192 WAQEHQKLTSSQRRTITGIFRSTPIGIVVKEAELSPAVSLLDNRQRRYAQRIMSLP 359 WAQ Q L + Q R ITG+F TPIG +++EA L PA L+D R RY R+++LP Sbjct: 110 WAQRIQILINKQARGITGMFPKTPIGALIREAALEPATVLMDARVARYTARLLALP 165 >ref|XP_002486420.1| reverse transcriptase, putative [Talaromyces stipitatus ATCC 10500] gi|218714759|gb|EED14182.1| reverse transcriptase, putative [Talaromyces stipitatus ATCC 10500] Length = 874 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/56 (48%), Positives = 36/56 (64%) Frame = +3 Query: 192 WAQEHQKLTSSQRRTITGIFRSTPIGIVVKEAELSPAVSLLDNRQRRYAQRIMSLP 359 W Q Q L + Q R ITG+F TPIG +++EA L PA L+D R RY R+++LP Sbjct: 392 WTQRIQILINKQARGITGMFPKTPIGALIREAALEPATVLMDARVARYTARLLALP 447 >ref|XP_002480767.1| hypothetical protein TSTA_035590 [Talaromyces stipitatus ATCC 10500] gi|218720914|gb|EED20333.1| hypothetical protein TSTA_035590 [Talaromyces stipitatus ATCC 10500] Length = 293 Score = 56.2 bits (134), Expect = 5e-06 Identities = 28/56 (50%), Positives = 36/56 (64%) Frame = +3 Query: 192 WAQEHQKLTSSQRRTITGIFRSTPIGIVVKEAELSPAVSLLDNRQRRYAQRIMSLP 359 WAQ Q L + Q R ITG+F TPIG +++EA L A LLD R RY R+++LP Sbjct: 200 WAQRIQILINKQARGITGMFPKTPIGALIREAALELATVLLDARVARYTARLLALP 255