BLASTX nr result
ID: Mentha25_contig00047433
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00047433 (417 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS59669.1| hypothetical protein M569_15136, partial [Genlise... 75 9e-12 ref|XP_006342753.1| PREDICTED: sucrose nonfermenting 4-like prot... 62 6e-08 ref|XP_004229201.1| PREDICTED: sucrose nonfermenting 4-like prot... 62 6e-08 >gb|EPS59669.1| hypothetical protein M569_15136, partial [Genlisea aurea] Length = 66 Score = 75.1 bits (183), Expect = 9e-12 Identities = 34/37 (91%), Positives = 34/37 (91%) Frame = +2 Query: 305 MYQLGMDYSRESGIVLIPTRFVWPYGGRVVYISGSFT 415 MY LGMDY RESGIVLIPTRFVWPYGGR VYISGSFT Sbjct: 1 MYPLGMDYPRESGIVLIPTRFVWPYGGRAVYISGSFT 37 >ref|XP_006342753.1| PREDICTED: sucrose nonfermenting 4-like protein-like isoform X1 [Solanum tuberosum] gi|565351620|ref|XP_006342754.1| PREDICTED: sucrose nonfermenting 4-like protein-like isoform X2 [Solanum tuberosum] Length = 486 Score = 62.4 bits (150), Expect = 6e-08 Identities = 26/37 (70%), Positives = 30/37 (81%) Frame = +2 Query: 305 MYQLGMDYSRESGIVLIPTRFVWPYGGRVVYISGSFT 415 MY MDY+R+ G LIPTRFVWPYGGR VY+SG+FT Sbjct: 1 MYPSAMDYARDGGTALIPTRFVWPYGGRSVYLSGTFT 37 >ref|XP_004229201.1| PREDICTED: sucrose nonfermenting 4-like protein-like [Solanum lycopersicum] Length = 487 Score = 62.4 bits (150), Expect = 6e-08 Identities = 26/37 (70%), Positives = 30/37 (81%) Frame = +2 Query: 305 MYQLGMDYSRESGIVLIPTRFVWPYGGRVVYISGSFT 415 MY MDY+R+ G LIPTRFVWPYGGR VY+SG+FT Sbjct: 1 MYPSAMDYARDGGTALIPTRFVWPYGGRSVYLSGTFT 37