BLASTX nr result
ID: Mentha25_contig00047432
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00047432 (366 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU32003.1| hypothetical protein MIMGU_mgv1a000101mg [Mimulus... 75 9e-12 ref|XP_006339441.1| PREDICTED: brefeldin A-inhibited guanine nuc... 75 1e-11 ref|XP_004229821.1| PREDICTED: brefeldin A-inhibited guanine nuc... 75 1e-11 gb|EXB52664.1| Brefeldin A-inhibited guanine nucleotide-exchange... 74 2e-11 ref|XP_002301299.2| hypothetical protein POPTR_0002s15020g [Popu... 74 2e-11 ref|XP_002301298.2| hypothetical protein POPTR_0002s15020g [Popu... 74 2e-11 ref|XP_007052034.1| SEC7-like guanine nucleotide exchange family... 74 2e-11 ref|XP_002511732.1| cytohesin 1, 2, 3, putative [Ricinus communi... 74 2e-11 ref|XP_002320064.1| guanine nucleotide exchange family protein [... 74 2e-11 ref|XP_004306910.1| PREDICTED: brefeldin A-inhibited guanine nuc... 72 6e-11 ref|XP_007220577.1| hypothetical protein PRUPE_ppa000110mg [Prun... 72 6e-11 ref|XP_006445235.1| hypothetical protein CICLE_v10018463mg [Citr... 69 5e-10 emb|CBI38863.3| unnamed protein product [Vitis vinifera] 69 7e-10 ref|XP_002279696.1| PREDICTED: brefeldin A-inhibited guanine nuc... 69 7e-10 ref|XP_006851811.1| hypothetical protein AMTR_s00041p00031550 [A... 69 9e-10 ref|XP_004155791.1| PREDICTED: LOW QUALITY PROTEIN: brefeldin A-... 69 9e-10 ref|XP_004133908.1| PREDICTED: brefeldin A-inhibited guanine nuc... 69 9e-10 ref|XP_004510941.1| PREDICTED: brefeldin A-inhibited guanine nuc... 68 1e-09 ref|XP_003623725.1| Brefeldin A-inhibited guanine nucleotide-exc... 68 1e-09 ref|XP_003534607.1| PREDICTED: brefeldin A-inhibited guanine nuc... 67 2e-09 >gb|EYU32003.1| hypothetical protein MIMGU_mgv1a000101mg [Mimulus guttatus] Length = 1789 Score = 75.1 bits (183), Expect = 9e-12 Identities = 36/38 (94%), Positives = 38/38 (100%) Frame = -1 Query: 363 FFPLLASLISCEHGSNEVQLALSDMLSSTVGPVLLRSC 250 FFPLL+SLISCEHGSNEVQLALSDMLSS+VGPVLLRSC Sbjct: 1752 FFPLLSSLISCEHGSNEVQLALSDMLSSSVGPVLLRSC 1789 >ref|XP_006339441.1| PREDICTED: brefeldin A-inhibited guanine nucleotide-exchange protein 2-like [Solanum tuberosum] Length = 1778 Score = 74.7 bits (182), Expect = 1e-11 Identities = 35/38 (92%), Positives = 38/38 (100%) Frame = -1 Query: 363 FFPLLASLISCEHGSNEVQLALSDMLSSTVGPVLLRSC 250 FFPLL+SLISCEHGSNE+QLALSDMLSS+VGPVLLRSC Sbjct: 1741 FFPLLSSLISCEHGSNEIQLALSDMLSSSVGPVLLRSC 1778 >ref|XP_004229821.1| PREDICTED: brefeldin A-inhibited guanine nucleotide-exchange protein 2-like [Solanum lycopersicum] Length = 1778 Score = 74.7 bits (182), Expect = 1e-11 Identities = 35/38 (92%), Positives = 38/38 (100%) Frame = -1 Query: 363 FFPLLASLISCEHGSNEVQLALSDMLSSTVGPVLLRSC 250 FFPLL+SLISCEHGSNE+QLALSDMLSS+VGPVLLRSC Sbjct: 1741 FFPLLSSLISCEHGSNEIQLALSDMLSSSVGPVLLRSC 1778 >gb|EXB52664.1| Brefeldin A-inhibited guanine nucleotide-exchange protein 2 [Morus notabilis] Length = 1764 Score = 73.9 bits (180), Expect = 2e-11 Identities = 35/38 (92%), Positives = 38/38 (100%) Frame = -1 Query: 363 FFPLLASLISCEHGSNEVQLALSDMLSSTVGPVLLRSC 250 FFPLL+SLISCEHGSNEVQ+ALSDMLSS+VGPVLLRSC Sbjct: 1727 FFPLLSSLISCEHGSNEVQVALSDMLSSSVGPVLLRSC 1764 >ref|XP_002301299.2| hypothetical protein POPTR_0002s15020g [Populus trichocarpa] gi|550345051|gb|EEE80572.2| hypothetical protein POPTR_0002s15020g [Populus trichocarpa] Length = 1360 Score = 73.9 bits (180), Expect = 2e-11 Identities = 35/38 (92%), Positives = 38/38 (100%) Frame = -1 Query: 363 FFPLLASLISCEHGSNEVQLALSDMLSSTVGPVLLRSC 250 FFPLL+SLISCEHGSNEVQ+ALSDMLSS+VGPVLLRSC Sbjct: 1323 FFPLLSSLISCEHGSNEVQVALSDMLSSSVGPVLLRSC 1360 >ref|XP_002301298.2| hypothetical protein POPTR_0002s15020g [Populus trichocarpa] gi|550345050|gb|EEE80571.2| hypothetical protein POPTR_0002s15020g [Populus trichocarpa] Length = 1783 Score = 73.9 bits (180), Expect = 2e-11 Identities = 35/38 (92%), Positives = 38/38 (100%) Frame = -1 Query: 363 FFPLLASLISCEHGSNEVQLALSDMLSSTVGPVLLRSC 250 FFPLL+SLISCEHGSNEVQ+ALSDMLSS+VGPVLLRSC Sbjct: 1746 FFPLLSSLISCEHGSNEVQVALSDMLSSSVGPVLLRSC 1783 >ref|XP_007052034.1| SEC7-like guanine nucleotide exchange family protein [Theobroma cacao] gi|508704295|gb|EOX96191.1| SEC7-like guanine nucleotide exchange family protein [Theobroma cacao] Length = 1778 Score = 73.9 bits (180), Expect = 2e-11 Identities = 35/38 (92%), Positives = 38/38 (100%) Frame = -1 Query: 363 FFPLLASLISCEHGSNEVQLALSDMLSSTVGPVLLRSC 250 FFPLL+SLISCEHGSNEVQ+ALSDMLSS+VGPVLLRSC Sbjct: 1741 FFPLLSSLISCEHGSNEVQVALSDMLSSSVGPVLLRSC 1778 >ref|XP_002511732.1| cytohesin 1, 2, 3, putative [Ricinus communis] gi|223548912|gb|EEF50401.1| cytohesin 1, 2, 3, putative [Ricinus communis] Length = 1780 Score = 73.9 bits (180), Expect = 2e-11 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = -1 Query: 363 FFPLLASLISCEHGSNEVQLALSDMLSSTVGPVLLRSC 250 FFPLL+ LISCEHGSNEVQ+ALSDMLSSTVGPVLLRSC Sbjct: 1743 FFPLLSGLISCEHGSNEVQVALSDMLSSTVGPVLLRSC 1780 >ref|XP_002320064.1| guanine nucleotide exchange family protein [Populus trichocarpa] gi|222860837|gb|EEE98379.1| guanine nucleotide exchange family protein [Populus trichocarpa] Length = 1783 Score = 73.9 bits (180), Expect = 2e-11 Identities = 35/38 (92%), Positives = 38/38 (100%) Frame = -1 Query: 363 FFPLLASLISCEHGSNEVQLALSDMLSSTVGPVLLRSC 250 FFPLL+SLISCEHGSNEVQ+ALSDMLSS+VGPVLLRSC Sbjct: 1746 FFPLLSSLISCEHGSNEVQVALSDMLSSSVGPVLLRSC 1783 >ref|XP_004306910.1| PREDICTED: brefeldin A-inhibited guanine nucleotide-exchange protein 2-like [Fragaria vesca subsp. vesca] Length = 1773 Score = 72.4 bits (176), Expect = 6e-11 Identities = 34/38 (89%), Positives = 38/38 (100%) Frame = -1 Query: 363 FFPLLASLISCEHGSNEVQLALSDMLSSTVGPVLLRSC 250 FFPLLA+LISCEHGS+EVQ+ALSDMLSS+VGPVLLRSC Sbjct: 1736 FFPLLATLISCEHGSDEVQIALSDMLSSSVGPVLLRSC 1773 >ref|XP_007220577.1| hypothetical protein PRUPE_ppa000110mg [Prunus persica] gi|462417039|gb|EMJ21776.1| hypothetical protein PRUPE_ppa000110mg [Prunus persica] Length = 1775 Score = 72.4 bits (176), Expect = 6e-11 Identities = 34/38 (89%), Positives = 37/38 (97%) Frame = -1 Query: 363 FFPLLASLISCEHGSNEVQLALSDMLSSTVGPVLLRSC 250 FFPLL+SLISCEHGSNEVQ+ALSDML S+VGPVLLRSC Sbjct: 1738 FFPLLSSLISCEHGSNEVQIALSDMLRSSVGPVLLRSC 1775 >ref|XP_006445235.1| hypothetical protein CICLE_v10018463mg [Citrus clementina] gi|568875718|ref|XP_006490939.1| PREDICTED: brefeldin A-inhibited guanine nucleotide-exchange protein 2-like [Citrus sinensis] gi|557547497|gb|ESR58475.1| hypothetical protein CICLE_v10018463mg [Citrus clementina] Length = 1779 Score = 69.3 bits (168), Expect = 5e-10 Identities = 30/38 (78%), Positives = 37/38 (97%) Frame = -1 Query: 363 FFPLLASLISCEHGSNEVQLALSDMLSSTVGPVLLRSC 250 FFPLL+SLISCEHGSNE+Q+ALSDML ++VGP+LLR+C Sbjct: 1742 FFPLLSSLISCEHGSNEIQVALSDMLDASVGPILLRTC 1779 >emb|CBI38863.3| unnamed protein product [Vitis vinifera] Length = 1753 Score = 68.9 bits (167), Expect = 7e-10 Identities = 32/38 (84%), Positives = 36/38 (94%) Frame = -1 Query: 363 FFPLLASLISCEHGSNEVQLALSDMLSSTVGPVLLRSC 250 FFPLL+SLI CEHGSNEVQ+ALS+ML S+VGPVLLRSC Sbjct: 1716 FFPLLSSLIGCEHGSNEVQVALSEMLRSSVGPVLLRSC 1753 >ref|XP_002279696.1| PREDICTED: brefeldin A-inhibited guanine nucleotide-exchange protein 1-like [Vitis vinifera] Length = 1779 Score = 68.9 bits (167), Expect = 7e-10 Identities = 32/38 (84%), Positives = 36/38 (94%) Frame = -1 Query: 363 FFPLLASLISCEHGSNEVQLALSDMLSSTVGPVLLRSC 250 FFPLL+SLI CEHGSNEVQ+ALS+ML S+VGPVLLRSC Sbjct: 1742 FFPLLSSLIGCEHGSNEVQVALSEMLRSSVGPVLLRSC 1779 >ref|XP_006851811.1| hypothetical protein AMTR_s00041p00031550 [Amborella trichopoda] gi|548855394|gb|ERN13278.1| hypothetical protein AMTR_s00041p00031550 [Amborella trichopoda] Length = 1791 Score = 68.6 bits (166), Expect = 9e-10 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = -1 Query: 363 FFPLLASLISCEHGSNEVQLALSDMLSSTVGPVLLRSC 250 FFPLL+ L+ CEHGSNEVQLALSDML S VGP+LLRSC Sbjct: 1754 FFPLLSGLVGCEHGSNEVQLALSDMLRSRVGPILLRSC 1791 >ref|XP_004155791.1| PREDICTED: LOW QUALITY PROTEIN: brefeldin A-inhibited guanine nucleotide-exchange protein 2-like [Cucumis sativus] Length = 1785 Score = 68.6 bits (166), Expect = 9e-10 Identities = 31/37 (83%), Positives = 37/37 (100%) Frame = -1 Query: 360 FPLLASLISCEHGSNEVQLALSDMLSSTVGPVLLRSC 250 FPLL+SLISCEHGSNEVQLALS+ML+++VGP+LLRSC Sbjct: 1749 FPLLSSLISCEHGSNEVQLALSEMLNTSVGPILLRSC 1785 >ref|XP_004133908.1| PREDICTED: brefeldin A-inhibited guanine nucleotide-exchange protein 2-like [Cucumis sativus] Length = 1785 Score = 68.6 bits (166), Expect = 9e-10 Identities = 31/37 (83%), Positives = 37/37 (100%) Frame = -1 Query: 360 FPLLASLISCEHGSNEVQLALSDMLSSTVGPVLLRSC 250 FPLL+SLISCEHGSNEVQLALS+ML+++VGP+LLRSC Sbjct: 1749 FPLLSSLISCEHGSNEVQLALSEMLNTSVGPILLRSC 1785 >ref|XP_004510941.1| PREDICTED: brefeldin A-inhibited guanine nucleotide-exchange protein 2-like [Cicer arietinum] Length = 1786 Score = 68.2 bits (165), Expect = 1e-09 Identities = 31/38 (81%), Positives = 36/38 (94%) Frame = -1 Query: 363 FFPLLASLISCEHGSNEVQLALSDMLSSTVGPVLLRSC 250 FFPLL+SL+SCEHGSNEVQ+AL DMLS +VGPVLL+SC Sbjct: 1749 FFPLLSSLVSCEHGSNEVQVALCDMLSLSVGPVLLKSC 1786 >ref|XP_003623725.1| Brefeldin A-inhibited guanine nucleotide-exchange protein [Medicago truncatula] gi|355498740|gb|AES79943.1| Brefeldin A-inhibited guanine nucleotide-exchange protein [Medicago truncatula] Length = 1789 Score = 68.2 bits (165), Expect = 1e-09 Identities = 32/38 (84%), Positives = 36/38 (94%) Frame = -1 Query: 363 FFPLLASLISCEHGSNEVQLALSDMLSSTVGPVLLRSC 250 FFPLL+SLISCEHGS EVQ+ALSDMLS +VGP+LLRSC Sbjct: 1752 FFPLLSSLISCEHGSTEVQVALSDMLSLSVGPLLLRSC 1789 >ref|XP_003534607.1| PREDICTED: brefeldin A-inhibited guanine nucleotide-exchange protein 2-like [Glycine max] Length = 1784 Score = 67.4 bits (163), Expect = 2e-09 Identities = 32/38 (84%), Positives = 36/38 (94%) Frame = -1 Query: 363 FFPLLASLISCEHGSNEVQLALSDMLSSTVGPVLLRSC 250 FFPLL+SLISCEHGS EVQ+ALSDMLS +VGP+LLRSC Sbjct: 1747 FFPLLSSLISCEHGSAEVQVALSDMLSLSVGPLLLRSC 1784