BLASTX nr result
ID: Mentha25_contig00047148
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00047148 (366 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU21693.1| hypothetical protein MIMGU_mgv1a024440mg, partial... 63 5e-08 ref|XP_006344442.1| PREDICTED: pentatricopeptide repeat-containi... 58 1e-06 ref|XP_004236239.1| PREDICTED: pentatricopeptide repeat-containi... 58 1e-06 ref|XP_002530453.1| pentatricopeptide repeat-containing protein,... 57 3e-06 ref|XP_002306508.1| pentatricopeptide repeat-containing family p... 56 5e-06 ref|XP_006652904.1| PREDICTED: pentatricopeptide repeat-containi... 56 6e-06 gb|EMT07565.1| hypothetical protein F775_06454 [Aegilops tauschii] 56 6e-06 ref|XP_002447206.1| hypothetical protein SORBIDRAFT_06g030430 [S... 56 6e-06 >gb|EYU21693.1| hypothetical protein MIMGU_mgv1a024440mg, partial [Mimulus guttatus] Length = 412 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/37 (78%), Positives = 34/37 (91%) Frame = -1 Query: 366 DVLLQKGLVDMARKYDDEMLLKGLSAKPRAELQRKMD 256 D LLQKGLVD+AR+YD+EML KG+SAKPRAELQ+K D Sbjct: 369 DALLQKGLVDIARRYDEEMLSKGISAKPRAELQKKTD 405 >ref|XP_006344442.1| PREDICTED: pentatricopeptide repeat-containing protein At1g80550, mitochondrial-like [Solanum tuberosum] Length = 467 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/36 (75%), Positives = 31/36 (86%) Frame = -1 Query: 366 DVLLQKGLVDMARKYDDEMLLKGLSAKPRAELQRKM 259 D L+QKG+VDMARKYD+EML KGLSAKPR EL K+ Sbjct: 424 DALVQKGMVDMARKYDEEMLAKGLSAKPRVELGTKL 459 >ref|XP_004236239.1| PREDICTED: pentatricopeptide repeat-containing protein At1g80550, mitochondrial-like [Solanum lycopersicum] Length = 467 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/36 (75%), Positives = 31/36 (86%) Frame = -1 Query: 366 DVLLQKGLVDMARKYDDEMLLKGLSAKPRAELQRKM 259 D L+QKG+VDMARKYD+EML KGLSAKPR EL K+ Sbjct: 424 DALVQKGMVDMARKYDEEMLAKGLSAKPRVELGTKL 459 >ref|XP_002530453.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223529998|gb|EEF31923.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 391 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/37 (67%), Positives = 33/37 (89%) Frame = -1 Query: 366 DVLLQKGLVDMARKYDDEMLLKGLSAKPRAELQRKMD 256 D L+QKG++ MAR+Y++EML KGLSAKPRAEL +K+D Sbjct: 352 DALVQKGMLHMARRYEEEMLAKGLSAKPRAELSKKVD 388 >ref|XP_002306508.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|222855957|gb|EEE93504.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 439 Score = 56.2 bits (134), Expect = 5e-06 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -1 Query: 366 DVLLQKGLVDMARKYDDEMLLKGLSAKPRAEL 271 D L+QKG+VDMARKYD+EM+ KGLSAKPR EL Sbjct: 403 DALIQKGMVDMARKYDEEMMAKGLSAKPRVEL 434 >ref|XP_006652904.1| PREDICTED: pentatricopeptide repeat-containing protein At1g80550, mitochondrial-like [Oryza brachyantha] Length = 444 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/36 (72%), Positives = 30/36 (83%) Frame = -1 Query: 366 DVLLQKGLVDMARKYDDEMLLKGLSAKPRAELQRKM 259 D LLQKG+VD+ARKYD+EML KGLS KPR EL K+ Sbjct: 394 DALLQKGMVDLARKYDEEMLAKGLSPKPRKELGTKL 429 >gb|EMT07565.1| hypothetical protein F775_06454 [Aegilops tauschii] Length = 274 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/36 (72%), Positives = 30/36 (83%) Frame = -1 Query: 366 DVLLQKGLVDMARKYDDEMLLKGLSAKPRAELQRKM 259 D LL+KG+VD+ARKYD+EML KGLS KPR EL KM Sbjct: 223 DALLEKGMVDLARKYDEEMLAKGLSPKPRKELGTKM 258 >ref|XP_002447206.1| hypothetical protein SORBIDRAFT_06g030430 [Sorghum bicolor] gi|241938389|gb|EES11534.1| hypothetical protein SORBIDRAFT_06g030430 [Sorghum bicolor] Length = 446 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/36 (72%), Positives = 30/36 (83%) Frame = -1 Query: 366 DVLLQKGLVDMARKYDDEMLLKGLSAKPRAELQRKM 259 D LLQKG+VD+ARKYD+EML KGLS KPR EL K+ Sbjct: 396 DALLQKGMVDLARKYDEEMLAKGLSPKPRKELGTKL 431