BLASTX nr result
ID: Mentha25_contig00047023
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00047023 (364 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEB37770.1| calmodulin-binding cyclic nucleotide gated channe... 121 2e-28 gb|ADO62407.1| putative cyclic nucleotide-gated channel [Heliant... 121 2e-28 gb|ADO62314.1| putative cyclic nucleotide-gated channel [Heliant... 121 2e-28 gb|AEB37795.1| calmodulin-binding cyclic nucleotide gated channe... 121 2e-28 gb|AEB37817.1| calmodulin-binding cyclic nucleotide gated channe... 121 3e-28 gb|AEB37793.1| calmodulin-binding cyclic nucleotide gated channe... 121 3e-28 gb|ADO62408.1| putative cyclic nucleotide-gated channel [Heliant... 121 3e-28 gb|ADO62354.1| putative cyclic nucleotide-gated channel [Heliant... 121 3e-28 ref|XP_007027344.1| Cyclic nucleotide-gated channel 15 isoform 1... 119 4e-28 ref|XP_007027345.1| Cyclic nucleotide-gated channel 15 isoform 2... 119 4e-28 gb|AEB37779.1| calmodulin-binding cyclic nucleotide gated channe... 121 4e-28 gb|ADO62374.1| putative cyclic nucleotide-gated channel [Heliant... 121 4e-28 gb|ADO62406.1| putative cyclic nucleotide-gated channel [Heliant... 119 7e-28 gb|ADO62392.1| putative cyclic nucleotide-gated channel [Heliant... 121 9e-28 gb|ADO62426.1| putative cyclic nucleotide-gated channel [Heliant... 121 9e-28 gb|ADO62356.1| putative cyclic nucleotide-gated channel [Heliant... 121 9e-28 gb|AEB37791.1| calmodulin-binding cyclic nucleotide gated channe... 121 9e-28 gb|ADO62336.1| putative cyclic nucleotide-gated channel [Heliant... 121 9e-28 gb|AEB37765.1| calmodulin-binding cyclic nucleotide gated channe... 121 9e-28 gb|ADO62375.1| putative cyclic nucleotide-gated channel [Heliant... 121 9e-28 >gb|AEB37770.1| calmodulin-binding cyclic nucleotide gated channel 15 [Helianthus petiolaris] Length = 184 Score = 121 bits (303), Expect(2) = 2e-28 Identities = 55/77 (71%), Positives = 67/77 (87%) Frame = -3 Query: 362 EFCGEELLSWAPYRRLTILLHSSTRPVRAITEVEAFALGADDLKFVTSQFRKVHNKHLRH 183 +FCGEELL+WA R +++L SSTR V+AI+EVEAFAL ADDLKFV SQFR++H+K LRH Sbjct: 83 DFCGEELLTWALDPRPSVILPSSTRTVKAISEVEAFALIADDLKFVASQFRRLHSKQLRH 142 Query: 182 KFRFHSHQWRTWGACFI 132 KFRF+SHQWRTW ACF+ Sbjct: 143 KFRFYSHQWRTWAACFV 159 Score = 30.0 bits (66), Expect(2) = 2e-28 Identities = 13/22 (59%), Positives = 15/22 (68%) Frame = -2 Query: 99 WFRYRRRKEAAVLKERERFAAV 34 W RY+RRK A LK RE F +V Sbjct: 163 WRRYKRRKSARELKARESFTSV 184 >gb|ADO62407.1| putative cyclic nucleotide-gated channel [Helianthus annuus] Length = 184 Score = 121 bits (303), Expect(2) = 2e-28 Identities = 55/77 (71%), Positives = 67/77 (87%) Frame = -3 Query: 362 EFCGEELLSWAPYRRLTILLHSSTRPVRAITEVEAFALGADDLKFVTSQFRKVHNKHLRH 183 +FCGEELL+WA R +++L SSTR V+AI+EVEAFAL ADDLKFV SQFR++H+K LRH Sbjct: 83 DFCGEELLTWALDPRPSVILPSSTRTVKAISEVEAFALIADDLKFVASQFRRLHSKQLRH 142 Query: 182 KFRFHSHQWRTWGACFI 132 KFRF+SHQWRTW ACF+ Sbjct: 143 KFRFYSHQWRTWAACFV 159 Score = 30.0 bits (66), Expect(2) = 2e-28 Identities = 13/22 (59%), Positives = 15/22 (68%) Frame = -2 Query: 99 WFRYRRRKEAAVLKERERFAAV 34 W RY+RRK A LK RE F +V Sbjct: 163 WRRYKRRKSARELKARESFTSV 184 >gb|ADO62314.1| putative cyclic nucleotide-gated channel [Helianthus argophyllus] gi|309256375|gb|ADO62315.1| putative cyclic nucleotide-gated channel [Helianthus argophyllus] gi|309256377|gb|ADO62316.1| putative cyclic nucleotide-gated channel [Helianthus argophyllus] gi|309256379|gb|ADO62317.1| putative cyclic nucleotide-gated channel [Helianthus argophyllus] gi|309256381|gb|ADO62318.1| putative cyclic nucleotide-gated channel [Helianthus argophyllus] gi|309256383|gb|ADO62319.1| putative cyclic nucleotide-gated channel [Helianthus argophyllus] gi|309256389|gb|ADO62322.1| putative cyclic nucleotide-gated channel [Helianthus argophyllus] gi|309256391|gb|ADO62323.1| putative cyclic nucleotide-gated channel [Helianthus argophyllus] gi|309256393|gb|ADO62324.1| putative cyclic nucleotide-gated channel [Helianthus argophyllus] gi|309256395|gb|ADO62325.1| putative cyclic nucleotide-gated channel [Helianthus argophyllus] gi|309256397|gb|ADO62326.1| putative cyclic nucleotide-gated channel [Helianthus annuus] gi|309256399|gb|ADO62327.1| putative cyclic nucleotide-gated channel [Helianthus annuus] gi|309256401|gb|ADO62328.1| putative cyclic nucleotide-gated channel [Helianthus annuus] gi|309256403|gb|ADO62329.1| putative cyclic nucleotide-gated channel [Helianthus annuus] gi|309256405|gb|ADO62330.1| putative cyclic nucleotide-gated channel [Helianthus annuus] gi|309256407|gb|ADO62331.1| putative cyclic nucleotide-gated channel [Helianthus annuus] gi|309256409|gb|ADO62332.1| putative cyclic nucleotide-gated channel [Helianthus annuus] gi|309256411|gb|ADO62333.1| putative cyclic nucleotide-gated channel [Helianthus annuus] gi|309256413|gb|ADO62334.1| putative cyclic nucleotide-gated channel [Helianthus annuus] gi|309256415|gb|ADO62335.1| putative cyclic nucleotide-gated channel [Helianthus annuus] gi|309256421|gb|ADO62338.1| putative cyclic nucleotide-gated channel [Helianthus annuus] gi|309256423|gb|ADO62339.1| putative cyclic nucleotide-gated channel [Helianthus annuus] gi|309256425|gb|ADO62340.1| putative cyclic nucleotide-gated channel [Helianthus annuus] gi|309256427|gb|ADO62341.1| putative cyclic nucleotide-gated channel [Helianthus annuus] gi|309256429|gb|ADO62342.1| putative cyclic nucleotide-gated channel [Helianthus annuus] gi|309256431|gb|ADO62343.1| putative cyclic nucleotide-gated channel [Helianthus annuus] gi|309256433|gb|ADO62344.1| putative cyclic nucleotide-gated channel [Helianthus annuus] gi|309256435|gb|ADO62345.1| putative cyclic nucleotide-gated channel [Helianthus annuus] gi|309256437|gb|ADO62346.1| putative cyclic nucleotide-gated channel [Helianthus annuus] gi|309256439|gb|ADO62347.1| putative cyclic nucleotide-gated channel [Helianthus annuus] gi|309256441|gb|ADO62348.1| putative cyclic nucleotide-gated channel [Helianthus annuus] gi|309256443|gb|ADO62349.1| putative cyclic nucleotide-gated channel [Helianthus annuus] gi|309256445|gb|ADO62350.1| putative cyclic nucleotide-gated channel [Helianthus annuus] gi|309256447|gb|ADO62351.1| putative cyclic nucleotide-gated channel [Helianthus annuus] gi|309256449|gb|ADO62352.1| putative cyclic nucleotide-gated channel [Helianthus annuus] gi|309256451|gb|ADO62353.1| putative cyclic nucleotide-gated channel [Helianthus annuus] gi|309256465|gb|ADO62360.1| putative cyclic nucleotide-gated channel [Helianthus annuus] gi|309256467|gb|ADO62361.1| putative cyclic nucleotide-gated channel [Helianthus annuus] gi|309256473|gb|ADO62364.1| putative cyclic nucleotide-gated channel [Helianthus annuus] gi|309256475|gb|ADO62365.1| putative cyclic nucleotide-gated channel [Helianthus annuus] gi|309256481|gb|ADO62368.1| putative cyclic nucleotide-gated channel [Helianthus annuus] gi|309256483|gb|ADO62369.1| putative cyclic nucleotide-gated channel [Helianthus annuus] gi|309256485|gb|ADO62370.1| putative cyclic nucleotide-gated channel [Helianthus annuus] gi|309256487|gb|ADO62371.1| putative cyclic nucleotide-gated channel [Helianthus annuus] gi|309256489|gb|ADO62372.1| putative cyclic nucleotide-gated channel [Helianthus annuus] gi|309256491|gb|ADO62373.1| putative cyclic nucleotide-gated channel [Helianthus annuus] gi|309256497|gb|ADO62376.1| putative cyclic nucleotide-gated channel [Helianthus annuus] gi|309256499|gb|ADO62377.1| putative cyclic nucleotide-gated channel [Helianthus annuus] gi|309256501|gb|ADO62378.1| putative cyclic nucleotide-gated channel [Helianthus annuus] gi|309256503|gb|ADO62379.1| putative cyclic nucleotide-gated channel [Helianthus annuus] gi|309256505|gb|ADO62380.1| putative cyclic nucleotide-gated channel [Helianthus annuus] gi|309256507|gb|ADO62381.1| putative cyclic nucleotide-gated channel [Helianthus annuus] gi|309256509|gb|ADO62382.1| putative cyclic nucleotide-gated channel [Helianthus annuus] gi|309256511|gb|ADO62383.1| putative cyclic nucleotide-gated channel [Helianthus annuus] gi|309256517|gb|ADO62386.1| putative cyclic nucleotide-gated channel [Helianthus annuus] gi|309256519|gb|ADO62387.1| putative cyclic nucleotide-gated channel [Helianthus annuus] gi|309256521|gb|ADO62388.1| putative cyclic nucleotide-gated channel [Helianthus annuus] gi|309256523|gb|ADO62389.1| putative cyclic nucleotide-gated channel [Helianthus annuus] gi|309256533|gb|ADO62394.1| putative cyclic nucleotide-gated channel [Helianthus annuus] gi|309256535|gb|ADO62395.1| putative cyclic nucleotide-gated channel [Helianthus annuus] gi|309256537|gb|ADO62396.1| putative cyclic nucleotide-gated channel [Helianthus annuus] gi|309256539|gb|ADO62397.1| putative cyclic nucleotide-gated channel [Helianthus annuus] gi|309256541|gb|ADO62398.1| putative cyclic nucleotide-gated channel [Helianthus annuus] gi|309256543|gb|ADO62399.1| putative cyclic nucleotide-gated channel [Helianthus annuus] gi|309256563|gb|ADO62409.1| putative cyclic nucleotide-gated channel [Helianthus annuus] gi|309256565|gb|ADO62410.1| putative cyclic nucleotide-gated channel [Helianthus annuus] gi|309256567|gb|ADO62411.1| putative cyclic nucleotide-gated channel [Helianthus annuus] gi|309256573|gb|ADO62414.1| putative cyclic nucleotide-gated channel [Helianthus annuus] gi|309256575|gb|ADO62415.1| putative cyclic nucleotide-gated channel [Helianthus annuus] gi|309256577|gb|ADO62416.1| putative cyclic nucleotide-gated channel [Helianthus annuus] gi|309256579|gb|ADO62417.1| putative cyclic nucleotide-gated channel [Helianthus annuus] gi|309256581|gb|ADO62418.1| putative cyclic nucleotide-gated channel [Helianthus annuus] gi|309256583|gb|ADO62419.1| putative cyclic nucleotide-gated channel [Helianthus annuus] gi|309256585|gb|ADO62420.1| putative cyclic nucleotide-gated channel [Helianthus annuus] gi|309256587|gb|ADO62421.1| putative cyclic nucleotide-gated channel [Helianthus annuus] gi|309256593|gb|ADO62424.1| putative cyclic nucleotide-gated channel [Helianthus annuus] gi|309256595|gb|ADO62425.1| putative cyclic nucleotide-gated channel [Helianthus annuus] gi|309256601|gb|ADO62428.1| putative cyclic nucleotide-gated channel [Helianthus annuus] gi|309256603|gb|ADO62429.1| putative cyclic nucleotide-gated channel [Helianthus annuus] gi|309256621|gb|ADO62438.1| putative cyclic nucleotide-gated channel [Helianthus annuus] gi|309256623|gb|ADO62439.1| putative cyclic nucleotide-gated channel [Helianthus annuus] gi|309256629|gb|ADO62442.1| putative cyclic nucleotide-gated channel [Helianthus annuus] gi|309256631|gb|ADO62443.1| putative cyclic nucleotide-gated channel [Helianthus annuus] gi|309256633|gb|ADO62444.1| putative cyclic nucleotide-gated channel [Helianthus annuus] gi|309256635|gb|ADO62445.1| putative cyclic nucleotide-gated channel [Helianthus annuus] gi|328692315|gb|AEB37769.1| calmodulin-binding cyclic nucleotide gated channel 15 [Helianthus petiolaris] gi|328692319|gb|AEB37771.1| calmodulin-binding cyclic nucleotide gated channel 15 [Helianthus petiolaris] gi|328692321|gb|AEB37772.1| calmodulin-binding cyclic nucleotide gated channel 15 [Helianthus petiolaris] gi|328692323|gb|AEB37773.1| calmodulin-binding cyclic nucleotide gated channel 15 [Helianthus petiolaris] gi|328692325|gb|AEB37774.1| calmodulin-binding cyclic nucleotide gated channel 15 [Helianthus petiolaris] gi|328692343|gb|AEB37783.1| calmodulin-binding cyclic nucleotide gated channel 15 [Helianthus paradoxus] gi|328692345|gb|AEB37784.1| calmodulin-binding cyclic nucleotide gated channel 15 [Helianthus paradoxus] gi|328692347|gb|AEB37785.1| calmodulin-binding cyclic nucleotide gated channel 15 [Helianthus paradoxus] gi|328692349|gb|AEB37786.1| calmodulin-binding cyclic nucleotide gated channel 15 [Helianthus paradoxus] gi|328692355|gb|AEB37789.1| calmodulin-binding cyclic nucleotide gated channel 15 [Helianthus exilis] gi|328692357|gb|AEB37790.1| calmodulin-binding cyclic nucleotide gated channel 15 [Helianthus exilis] gi|328692371|gb|AEB37797.1| calmodulin-binding cyclic nucleotide gated channel 15 [Helianthus exilis] gi|328692373|gb|AEB37798.1| calmodulin-binding cyclic nucleotide gated channel 15 [Helianthus exilis] gi|328692379|gb|AEB37801.1| calmodulin-binding cyclic nucleotide gated channel 15 [Helianthus tuberosus] gi|328692383|gb|AEB37803.1| calmodulin-binding cyclic nucleotide gated channel 15 [Helianthus tuberosus] gi|328692387|gb|AEB37805.1| calmodulin-binding cyclic nucleotide gated channel 15 [Helianthus tuberosus] gi|328692389|gb|AEB37806.1| calmodulin-binding cyclic nucleotide gated channel 15 [Helianthus tuberosus] gi|328692391|gb|AEB37807.1| calmodulin-binding cyclic nucleotide gated channel 15 [Helianthus tuberosus] gi|328692393|gb|AEB37808.1| calmodulin-binding cyclic nucleotide gated channel 15 [Helianthus tuberosus] gi|328692395|gb|AEB37809.1| calmodulin-binding cyclic nucleotide gated channel 15 [Helianthus tuberosus] gi|328692399|gb|AEB37811.1| calmodulin-binding cyclic nucleotide gated channel 15 [Helianthus tuberosus] gi|328692403|gb|AEB37813.1| calmodulin-binding cyclic nucleotide gated channel 15 [Helianthus tuberosus] gi|328692405|gb|AEB37814.1| calmodulin-binding cyclic nucleotide gated channel 15 [Helianthus tuberosus] gi|328692407|gb|AEB37815.1| calmodulin-binding cyclic nucleotide gated channel 15 [Helianthus tuberosus] gi|328692415|gb|AEB37819.1| calmodulin-binding cyclic nucleotide gated channel 15 [Helianthus tuberosus] gi|328692417|gb|AEB37820.1| calmodulin-binding cyclic nucleotide gated channel 15 [Helianthus tuberosus] gi|328692423|gb|AEB37823.1| calmodulin-binding cyclic nucleotide gated channel 15 [Helianthus tuberosus] gi|328692425|gb|AEB37824.1| calmodulin-binding cyclic nucleotide gated channel 15 [Helianthus tuberosus] Length = 184 Score = 121 bits (303), Expect(2) = 2e-28 Identities = 55/77 (71%), Positives = 67/77 (87%) Frame = -3 Query: 362 EFCGEELLSWAPYRRLTILLHSSTRPVRAITEVEAFALGADDLKFVTSQFRKVHNKHLRH 183 +FCGEELL+WA R +++L SSTR V+AI+EVEAFAL ADDLKFV SQFR++H+K LRH Sbjct: 83 DFCGEELLTWALDPRPSVILPSSTRTVKAISEVEAFALIADDLKFVASQFRRLHSKQLRH 142 Query: 182 KFRFHSHQWRTWGACFI 132 KFRF+SHQWRTW ACF+ Sbjct: 143 KFRFYSHQWRTWAACFV 159 Score = 30.0 bits (66), Expect(2) = 2e-28 Identities = 13/22 (59%), Positives = 15/22 (68%) Frame = -2 Query: 99 WFRYRRRKEAAVLKERERFAAV 34 W RY+RRK A LK RE F +V Sbjct: 163 WRRYKRRKSARELKARESFTSV 184 >gb|AEB37795.1| calmodulin-binding cyclic nucleotide gated channel 15 [Helianthus exilis] Length = 183 Score = 121 bits (303), Expect(2) = 2e-28 Identities = 55/77 (71%), Positives = 67/77 (87%) Frame = -3 Query: 362 EFCGEELLSWAPYRRLTILLHSSTRPVRAITEVEAFALGADDLKFVTSQFRKVHNKHLRH 183 +FCGEELL+WA R +++L SSTR V+AI+EVEAFAL ADDLKFV SQFR++H+K LRH Sbjct: 82 DFCGEELLTWALDPRPSVILPSSTRTVKAISEVEAFALIADDLKFVASQFRRLHSKQLRH 141 Query: 182 KFRFHSHQWRTWGACFI 132 KFRF+SHQWRTW ACF+ Sbjct: 142 KFRFYSHQWRTWAACFV 158 Score = 30.0 bits (66), Expect(2) = 2e-28 Identities = 13/22 (59%), Positives = 15/22 (68%) Frame = -2 Query: 99 WFRYRRRKEAAVLKERERFAAV 34 W RY+RRK A LK RE F +V Sbjct: 162 WRRYKRRKSARELKARESFTSV 183 >gb|AEB37817.1| calmodulin-binding cyclic nucleotide gated channel 15 [Helianthus tuberosus] Length = 184 Score = 121 bits (303), Expect(2) = 3e-28 Identities = 55/77 (71%), Positives = 67/77 (87%) Frame = -3 Query: 362 EFCGEELLSWAPYRRLTILLHSSTRPVRAITEVEAFALGADDLKFVTSQFRKVHNKHLRH 183 +FCGEELL+WA R +++L SSTR V+AI+EVEAFAL ADDLKFV SQFR++H+K LRH Sbjct: 83 DFCGEELLTWALDPRPSVILPSSTRTVKAISEVEAFALIADDLKFVASQFRRLHSKQLRH 142 Query: 182 KFRFHSHQWRTWGACFI 132 KFRF+SHQWRTW ACF+ Sbjct: 143 KFRFYSHQWRTWAACFV 159 Score = 29.6 bits (65), Expect(2) = 3e-28 Identities = 13/22 (59%), Positives = 15/22 (68%) Frame = -2 Query: 99 WFRYRRRKEAAVLKERERFAAV 34 W RY+RRK A LK RE F +V Sbjct: 163 WRRYKRRKSARELKVRESFTSV 184 >gb|AEB37793.1| calmodulin-binding cyclic nucleotide gated channel 15 [Helianthus exilis] gi|328692365|gb|AEB37794.1| calmodulin-binding cyclic nucleotide gated channel 15 [Helianthus exilis] Length = 184 Score = 121 bits (303), Expect(2) = 3e-28 Identities = 55/77 (71%), Positives = 67/77 (87%) Frame = -3 Query: 362 EFCGEELLSWAPYRRLTILLHSSTRPVRAITEVEAFALGADDLKFVTSQFRKVHNKHLRH 183 +FCGEELL+WA R +++L SSTR V+AI+EVEAFAL ADDLKFV SQFR++H+K LRH Sbjct: 83 DFCGEELLTWALDPRPSVILPSSTRTVKAISEVEAFALIADDLKFVASQFRRLHSKQLRH 142 Query: 182 KFRFHSHQWRTWGACFI 132 KFRF+SHQWRTW ACF+ Sbjct: 143 KFRFYSHQWRTWAACFV 159 Score = 29.6 bits (65), Expect(2) = 3e-28 Identities = 13/22 (59%), Positives = 15/22 (68%) Frame = -2 Query: 99 WFRYRRRKEAAVLKERERFAAV 34 W RY+RRK A LK RE F +V Sbjct: 163 WRRYKRRKSARELKARESFKSV 184 >gb|ADO62408.1| putative cyclic nucleotide-gated channel [Helianthus annuus] Length = 184 Score = 121 bits (303), Expect(2) = 3e-28 Identities = 55/77 (71%), Positives = 67/77 (87%) Frame = -3 Query: 362 EFCGEELLSWAPYRRLTILLHSSTRPVRAITEVEAFALGADDLKFVTSQFRKVHNKHLRH 183 +FCGEELL+WA R +++L SSTR V+AI+EVEAFAL ADDLKFV SQFR++H+K LRH Sbjct: 83 DFCGEELLTWALDPRPSVILPSSTRTVKAISEVEAFALIADDLKFVASQFRRLHSKQLRH 142 Query: 182 KFRFHSHQWRTWGACFI 132 KFRF+SHQWRTW ACF+ Sbjct: 143 KFRFYSHQWRTWAACFV 159 Score = 29.6 bits (65), Expect(2) = 3e-28 Identities = 13/22 (59%), Positives = 15/22 (68%) Frame = -2 Query: 99 WFRYRRRKEAAVLKERERFAAV 34 W RY+RRK A LK RE F +V Sbjct: 163 WPRYKRRKSARELKARESFTSV 184 >gb|ADO62354.1| putative cyclic nucleotide-gated channel [Helianthus annuus] gi|309256455|gb|ADO62355.1| putative cyclic nucleotide-gated channel [Helianthus annuus] Length = 184 Score = 121 bits (303), Expect(2) = 3e-28 Identities = 55/77 (71%), Positives = 67/77 (87%) Frame = -3 Query: 362 EFCGEELLSWAPYRRLTILLHSSTRPVRAITEVEAFALGADDLKFVTSQFRKVHNKHLRH 183 +FCGEELL+WA R +++L SSTR V+AI+EVEAFAL ADDLKFV SQFR++H+K LRH Sbjct: 83 DFCGEELLTWALDPRPSVILPSSTRTVKAISEVEAFALIADDLKFVASQFRRLHSKQLRH 142 Query: 182 KFRFHSHQWRTWGACFI 132 KFRF+SHQWRTW ACF+ Sbjct: 143 KFRFYSHQWRTWAACFV 159 Score = 29.6 bits (65), Expect(2) = 3e-28 Identities = 13/22 (59%), Positives = 15/22 (68%) Frame = -2 Query: 99 WFRYRRRKEAAVLKERERFAAV 34 W RY+RRK A LK RE F +V Sbjct: 163 WRRYKRRKSARELKARESFRSV 184 >ref|XP_007027344.1| Cyclic nucleotide-gated channel 15 isoform 1 [Theobroma cacao] gi|508715949|gb|EOY07846.1| Cyclic nucleotide-gated channel 15 isoform 1 [Theobroma cacao] Length = 712 Score = 119 bits (298), Expect(2) = 4e-28 Identities = 55/77 (71%), Positives = 65/77 (84%) Frame = -3 Query: 362 EFCGEELLSWAPYRRLTILLHSSTRPVRAITEVEAFALGADDLKFVTSQFRKVHNKHLRH 183 +FCGEELL+WA R I+L SSTR V+AITEVEAFAL ++DLKFV +QFR++H+K LRH Sbjct: 547 DFCGEELLTWALDPRPNIVLPSSTRTVKAITEVEAFALVSEDLKFVAAQFRRLHSKQLRH 606 Query: 182 KFRFHSHQWRTWGACFI 132 FRFHSHQWRTW ACFI Sbjct: 607 TFRFHSHQWRTWAACFI 623 Score = 31.2 bits (69), Expect(2) = 4e-28 Identities = 17/33 (51%), Positives = 20/33 (60%) Frame = -2 Query: 99 WFRYRRRKEAAVLKERERFAAVSRPRFVPERCT 1 WFRY+RRK A LK+ E AA S PE+ T Sbjct: 627 WFRYKRRKGVAELKKWESMAASS-----PEQAT 654 >ref|XP_007027345.1| Cyclic nucleotide-gated channel 15 isoform 2 [Theobroma cacao] gi|508715950|gb|EOY07847.1| Cyclic nucleotide-gated channel 15 isoform 2 [Theobroma cacao] Length = 681 Score = 119 bits (298), Expect(2) = 4e-28 Identities = 55/77 (71%), Positives = 65/77 (84%) Frame = -3 Query: 362 EFCGEELLSWAPYRRLTILLHSSTRPVRAITEVEAFALGADDLKFVTSQFRKVHNKHLRH 183 +FCGEELL+WA R I+L SSTR V+AITEVEAFAL ++DLKFV +QFR++H+K LRH Sbjct: 516 DFCGEELLTWALDPRPNIVLPSSTRTVKAITEVEAFALVSEDLKFVAAQFRRLHSKQLRH 575 Query: 182 KFRFHSHQWRTWGACFI 132 FRFHSHQWRTW ACFI Sbjct: 576 TFRFHSHQWRTWAACFI 592 Score = 31.2 bits (69), Expect(2) = 4e-28 Identities = 17/33 (51%), Positives = 20/33 (60%) Frame = -2 Query: 99 WFRYRRRKEAAVLKERERFAAVSRPRFVPERCT 1 WFRY+RRK A LK+ E AA S PE+ T Sbjct: 596 WFRYKRRKGVAELKKWESMAASS-----PEQAT 623 >gb|AEB37779.1| calmodulin-binding cyclic nucleotide gated channel 15 [Helianthus paradoxus] gi|328692337|gb|AEB37780.1| calmodulin-binding cyclic nucleotide gated channel 15 [Helianthus paradoxus] gi|328692339|gb|AEB37781.1| calmodulin-binding cyclic nucleotide gated channel 15 [Helianthus paradoxus] gi|328692341|gb|AEB37782.1| calmodulin-binding cyclic nucleotide gated channel 15 [Helianthus paradoxus] gi|328692351|gb|AEB37787.1| calmodulin-binding cyclic nucleotide gated channel 15 [Helianthus paradoxus] gi|328692353|gb|AEB37788.1| calmodulin-binding cyclic nucleotide gated channel 15 [Helianthus paradoxus] Length = 184 Score = 121 bits (303), Expect(2) = 4e-28 Identities = 55/77 (71%), Positives = 67/77 (87%) Frame = -3 Query: 362 EFCGEELLSWAPYRRLTILLHSSTRPVRAITEVEAFALGADDLKFVTSQFRKVHNKHLRH 183 +FCGEELL+WA R +++L SSTR V+AI+EVEAFAL ADDLKFV SQFR++H+K LRH Sbjct: 83 DFCGEELLTWALDPRPSVILPSSTRTVKAISEVEAFALIADDLKFVASQFRRLHSKQLRH 142 Query: 182 KFRFHSHQWRTWGACFI 132 KFRF+SHQWRTW ACF+ Sbjct: 143 KFRFYSHQWRTWAACFV 159 Score = 29.3 bits (64), Expect(2) = 4e-28 Identities = 13/22 (59%), Positives = 15/22 (68%) Frame = -2 Query: 99 WFRYRRRKEAAVLKERERFAAV 34 W RY+RRK A LK RE F +V Sbjct: 163 WRRYKRRKSAWELKARESFTSV 184 >gb|ADO62374.1| putative cyclic nucleotide-gated channel [Helianthus annuus] Length = 184 Score = 121 bits (303), Expect(2) = 4e-28 Identities = 55/77 (71%), Positives = 67/77 (87%) Frame = -3 Query: 362 EFCGEELLSWAPYRRLTILLHSSTRPVRAITEVEAFALGADDLKFVTSQFRKVHNKHLRH 183 +FCGEELL+WA R +++L SSTR V+AI+EVEAFAL ADDLKFV SQFR++H+K LRH Sbjct: 83 DFCGEELLTWALDPRPSVILPSSTRTVKAISEVEAFALIADDLKFVASQFRRLHSKQLRH 142 Query: 182 KFRFHSHQWRTWGACFI 132 KFRF+SHQWRTW ACF+ Sbjct: 143 KFRFYSHQWRTWAACFV 159 Score = 29.3 bits (64), Expect(2) = 4e-28 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = -2 Query: 99 WFRYRRRKEAAVLKERERFAAV 34 W RY+RRK A LK RE F V Sbjct: 163 WRRYKRRKSARELKARESFTRV 184 >gb|ADO62406.1| putative cyclic nucleotide-gated channel [Helianthus annuus] Length = 184 Score = 119 bits (299), Expect(2) = 7e-28 Identities = 54/77 (70%), Positives = 67/77 (87%) Frame = -3 Query: 362 EFCGEELLSWAPYRRLTILLHSSTRPVRAITEVEAFALGADDLKFVTSQFRKVHNKHLRH 183 +FCGEELL+WA R +++L SSTR V+AI+EVEAFAL ADDLKFV SQFR++H++ LRH Sbjct: 83 DFCGEELLTWALDPRPSVILPSSTRTVKAISEVEAFALIADDLKFVASQFRRLHSEQLRH 142 Query: 182 KFRFHSHQWRTWGACFI 132 KFRF+SHQWRTW ACF+ Sbjct: 143 KFRFYSHQWRTWAACFV 159 Score = 30.0 bits (66), Expect(2) = 7e-28 Identities = 13/22 (59%), Positives = 15/22 (68%) Frame = -2 Query: 99 WFRYRRRKEAAVLKERERFAAV 34 W RY+RRK A LK RE F +V Sbjct: 163 WRRYKRRKSARELKARESFTSV 184 >gb|ADO62392.1| putative cyclic nucleotide-gated channel [Helianthus annuus] gi|309256531|gb|ADO62393.1| putative cyclic nucleotide-gated channel [Helianthus annuus] gi|328692381|gb|AEB37802.1| calmodulin-binding cyclic nucleotide gated channel 15 [Helianthus tuberosus] Length = 182 Score = 121 bits (303), Expect(2) = 9e-28 Identities = 55/77 (71%), Positives = 67/77 (87%) Frame = -3 Query: 362 EFCGEELLSWAPYRRLTILLHSSTRPVRAITEVEAFALGADDLKFVTSQFRKVHNKHLRH 183 +FCGEELL+WA R +++L SSTR V+AI+EVEAFAL ADDLKFV SQFR++H+K LRH Sbjct: 83 DFCGEELLTWALDPRPSVILPSSTRTVKAISEVEAFALIADDLKFVASQFRRLHSKQLRH 142 Query: 182 KFRFHSHQWRTWGACFI 132 KFRF+SHQWRTW ACF+ Sbjct: 143 KFRFYSHQWRTWAACFV 159 Score = 28.1 bits (61), Expect(2) = 9e-28 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = -2 Query: 99 WFRYRRRKEAAVLKERERF 43 W RY+RRK A LK RE F Sbjct: 163 WRRYKRRKSARELKARESF 181 >gb|ADO62426.1| putative cyclic nucleotide-gated channel [Helianthus annuus] gi|309256599|gb|ADO62427.1| putative cyclic nucleotide-gated channel [Helianthus annuus] gi|328692369|gb|AEB37796.1| calmodulin-binding cyclic nucleotide gated channel 15 [Helianthus exilis] gi|328692413|gb|AEB37818.1| calmodulin-binding cyclic nucleotide gated channel 15 [Helianthus tuberosus] Length = 181 Score = 121 bits (303), Expect(2) = 9e-28 Identities = 55/77 (71%), Positives = 67/77 (87%) Frame = -3 Query: 362 EFCGEELLSWAPYRRLTILLHSSTRPVRAITEVEAFALGADDLKFVTSQFRKVHNKHLRH 183 +FCGEELL+WA R +++L SSTR V+AI+EVEAFAL ADDLKFV SQFR++H+K LRH Sbjct: 82 DFCGEELLTWALDPRPSVILPSSTRTVKAISEVEAFALIADDLKFVASQFRRLHSKQLRH 141 Query: 182 KFRFHSHQWRTWGACFI 132 KFRF+SHQWRTW ACF+ Sbjct: 142 KFRFYSHQWRTWAACFV 158 Score = 28.1 bits (61), Expect(2) = 9e-28 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = -2 Query: 99 WFRYRRRKEAAVLKERERF 43 W RY+RRK A LK RE F Sbjct: 162 WRRYKRRKSARELKARESF 180 >gb|ADO62356.1| putative cyclic nucleotide-gated channel [Helianthus annuus] gi|309256459|gb|ADO62357.1| putative cyclic nucleotide-gated channel [Helianthus annuus] gi|309256469|gb|ADO62362.1| putative cyclic nucleotide-gated channel [Helianthus annuus] gi|309256471|gb|ADO62363.1| putative cyclic nucleotide-gated channel [Helianthus annuus] Length = 181 Score = 121 bits (303), Expect(2) = 9e-28 Identities = 55/77 (71%), Positives = 67/77 (87%) Frame = -3 Query: 362 EFCGEELLSWAPYRRLTILLHSSTRPVRAITEVEAFALGADDLKFVTSQFRKVHNKHLRH 183 +FCGEELL+WA R +++L SSTR V+AI+EVEAFAL ADDLKFV SQFR++H+K LRH Sbjct: 83 DFCGEELLTWALDPRPSVILPSSTRTVKAISEVEAFALIADDLKFVASQFRRLHSKQLRH 142 Query: 182 KFRFHSHQWRTWGACFI 132 KFRF+SHQWRTW ACF+ Sbjct: 143 KFRFYSHQWRTWAACFV 159 Score = 28.1 bits (61), Expect(2) = 9e-28 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = -2 Query: 99 WFRYRRRKEAAVLKERERF 43 W RY+RRK A LK RE F Sbjct: 163 WRRYKRRKSARELKARESF 181 >gb|AEB37791.1| calmodulin-binding cyclic nucleotide gated channel 15 [Helianthus exilis] Length = 180 Score = 121 bits (303), Expect(2) = 9e-28 Identities = 55/77 (71%), Positives = 67/77 (87%) Frame = -3 Query: 362 EFCGEELLSWAPYRRLTILLHSSTRPVRAITEVEAFALGADDLKFVTSQFRKVHNKHLRH 183 +FCGEELL+WA R +++L SSTR V+AI+EVEAFAL ADDLKFV SQFR++H+K LRH Sbjct: 81 DFCGEELLTWALDPRPSVILPSSTRTVKAISEVEAFALIADDLKFVASQFRRLHSKQLRH 140 Query: 182 KFRFHSHQWRTWGACFI 132 KFRF+SHQWRTW ACF+ Sbjct: 141 KFRFYSHQWRTWAACFV 157 Score = 28.1 bits (61), Expect(2) = 9e-28 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = -2 Query: 99 WFRYRRRKEAAVLKERERF 43 W RY+RRK A LK RE F Sbjct: 161 WRRYKRRKSARELKARESF 179 >gb|ADO62336.1| putative cyclic nucleotide-gated channel [Helianthus annuus] gi|309256419|gb|ADO62337.1| putative cyclic nucleotide-gated channel [Helianthus annuus] gi|309256461|gb|ADO62358.1| putative cyclic nucleotide-gated channel [Helianthus annuus] gi|309256463|gb|ADO62359.1| putative cyclic nucleotide-gated channel [Helianthus annuus] gi|309256477|gb|ADO62366.1| putative cyclic nucleotide-gated channel [Helianthus annuus] gi|309256479|gb|ADO62367.1| putative cyclic nucleotide-gated channel [Helianthus annuus] gi|309256525|gb|ADO62390.1| putative cyclic nucleotide-gated channel [Helianthus annuus] gi|309256527|gb|ADO62391.1| putative cyclic nucleotide-gated channel [Helianthus annuus] gi|309256545|gb|ADO62400.1| putative cyclic nucleotide-gated channel [Helianthus annuus] gi|309256547|gb|ADO62401.1| putative cyclic nucleotide-gated channel [Helianthus annuus] gi|309256549|gb|ADO62402.1| putative cyclic nucleotide-gated channel [Helianthus annuus] gi|309256551|gb|ADO62403.1| putative cyclic nucleotide-gated channel [Helianthus annuus] gi|309256553|gb|ADO62404.1| putative cyclic nucleotide-gated channel [Helianthus annuus] gi|309256555|gb|ADO62405.1| putative cyclic nucleotide-gated channel [Helianthus annuus] gi|309256569|gb|ADO62412.1| putative cyclic nucleotide-gated channel [Helianthus annuus] gi|309256571|gb|ADO62413.1| putative cyclic nucleotide-gated channel [Helianthus annuus] gi|309256589|gb|ADO62422.1| putative cyclic nucleotide-gated channel [Helianthus annuus] gi|309256591|gb|ADO62423.1| putative cyclic nucleotide-gated channel [Helianthus annuus] gi|309256609|gb|ADO62432.1| putative cyclic nucleotide-gated channel [Helianthus annuus] gi|309256611|gb|ADO62433.1| putative cyclic nucleotide-gated channel [Helianthus annuus] gi|309256613|gb|ADO62434.1| putative cyclic nucleotide-gated channel [Helianthus annuus] gi|309256615|gb|ADO62435.1| putative cyclic nucleotide-gated channel [Helianthus annuus] gi|309256617|gb|ADO62436.1| putative cyclic nucleotide-gated channel [Helianthus annuus] gi|309256619|gb|ADO62437.1| putative cyclic nucleotide-gated channel [Helianthus annuus] gi|309256625|gb|ADO62440.1| putative cyclic nucleotide-gated channel [Helianthus annuus] gi|309256627|gb|ADO62441.1| putative cyclic nucleotide-gated channel [Helianthus annuus] gi|328692311|gb|AEB37767.1| calmodulin-binding cyclic nucleotide gated channel 15 [Helianthus petiolaris] gi|328692313|gb|AEB37768.1| calmodulin-binding cyclic nucleotide gated channel 15 [Helianthus petiolaris] gi|328692327|gb|AEB37775.1| calmodulin-binding cyclic nucleotide gated channel 15 [Helianthus petiolaris] gi|328692329|gb|AEB37776.1| calmodulin-binding cyclic nucleotide gated channel 15 [Helianthus petiolaris] gi|328692331|gb|AEB37777.1| calmodulin-binding cyclic nucleotide gated channel 15 [Helianthus paradoxus] gi|328692361|gb|AEB37792.1| calmodulin-binding cyclic nucleotide gated channel 15 [Helianthus exilis] gi|328692375|gb|AEB37799.1| calmodulin-binding cyclic nucleotide gated channel 15 [Helianthus exilis] gi|328692377|gb|AEB37800.1| calmodulin-binding cyclic nucleotide gated channel 15 [Helianthus exilis] gi|328692409|gb|AEB37816.1| calmodulin-binding cyclic nucleotide gated channel 15 [Helianthus tuberosus] Length = 180 Score = 121 bits (303), Expect(2) = 9e-28 Identities = 55/77 (71%), Positives = 67/77 (87%) Frame = -3 Query: 362 EFCGEELLSWAPYRRLTILLHSSTRPVRAITEVEAFALGADDLKFVTSQFRKVHNKHLRH 183 +FCGEELL+WA R +++L SSTR V+AI+EVEAFAL ADDLKFV SQFR++H+K LRH Sbjct: 81 DFCGEELLTWALDPRPSVILPSSTRTVKAISEVEAFALIADDLKFVASQFRRLHSKQLRH 140 Query: 182 KFRFHSHQWRTWGACFI 132 KFRF+SHQWRTW ACF+ Sbjct: 141 KFRFYSHQWRTWAACFV 157 Score = 28.1 bits (61), Expect(2) = 9e-28 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = -2 Query: 99 WFRYRRRKEAAVLKERERF 43 W RY+RRK A LK RE F Sbjct: 161 WRRYKRRKSARELKARESF 179 >gb|AEB37765.1| calmodulin-binding cyclic nucleotide gated channel 15 [Helianthus petiolaris] gi|328692309|gb|AEB37766.1| calmodulin-binding cyclic nucleotide gated channel 15 [Helianthus petiolaris] Length = 179 Score = 121 bits (303), Expect(2) = 9e-28 Identities = 55/77 (71%), Positives = 67/77 (87%) Frame = -3 Query: 362 EFCGEELLSWAPYRRLTILLHSSTRPVRAITEVEAFALGADDLKFVTSQFRKVHNKHLRH 183 +FCGEELL+WA R +++L SSTR V+AI+EVEAFAL ADDLKFV SQFR++H+K LRH Sbjct: 80 DFCGEELLTWALDPRPSVILPSSTRTVKAISEVEAFALIADDLKFVASQFRRLHSKQLRH 139 Query: 182 KFRFHSHQWRTWGACFI 132 KFRF+SHQWRTW ACF+ Sbjct: 140 KFRFYSHQWRTWAACFV 156 Score = 28.1 bits (61), Expect(2) = 9e-28 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = -2 Query: 99 WFRYRRRKEAAVLKERERF 43 W RY+RRK A LK RE F Sbjct: 160 WRRYKRRKSARELKARESF 178 >gb|ADO62375.1| putative cyclic nucleotide-gated channel [Helianthus annuus] gi|309256605|gb|ADO62430.1| putative cyclic nucleotide-gated channel [Helianthus annuus] gi|309256607|gb|ADO62431.1| putative cyclic nucleotide-gated channel [Helianthus annuus] Length = 179 Score = 121 bits (303), Expect(2) = 9e-28 Identities = 55/77 (71%), Positives = 67/77 (87%) Frame = -3 Query: 362 EFCGEELLSWAPYRRLTILLHSSTRPVRAITEVEAFALGADDLKFVTSQFRKVHNKHLRH 183 +FCGEELL+WA R +++L SSTR V+AI+EVEAFAL ADDLKFV SQFR++H+K LRH Sbjct: 81 DFCGEELLTWALDPRPSVILPSSTRTVKAISEVEAFALIADDLKFVASQFRRLHSKQLRH 140 Query: 182 KFRFHSHQWRTWGACFI 132 KFRF+SHQWRTW ACF+ Sbjct: 141 KFRFYSHQWRTWAACFV 157 Score = 28.1 bits (61), Expect(2) = 9e-28 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = -2 Query: 99 WFRYRRRKEAAVLKERERF 43 W RY+RRK A LK RE F Sbjct: 161 WRRYKRRKSARELKARESF 179