BLASTX nr result
ID: Mentha25_contig00046151
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00046151 (395 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU36123.1| hypothetical protein MIMGU_mgv1a0009921mg, partia... 64 3e-08 >gb|EYU36123.1| hypothetical protein MIMGU_mgv1a0009921mg, partial [Mimulus guttatus] Length = 905 Score = 63.5 bits (153), Expect = 3e-08 Identities = 39/98 (39%), Positives = 50/98 (51%) Frame = +2 Query: 92 DMDTSEIVVSSIRAGMKREFAFMMKAQSEMGGLPAXXXXXXXXXXXXXXXXYAVTDIKFT 271 DMD+ EIVVSSIRAGMKREFA MMKAQS++GGL A D+ + Sbjct: 1 DMDSGEIVVSSIRAGMKREFALMMKAQSQLGGLSASRRRVTRSQSSGCSSKGVHGDVTIS 60 Query: 272 RRPKGSASXXXXXXXXXXXXXXDVVKLEPSNVLDGDNG 385 ++ K S S + KLE ++ DG+ G Sbjct: 61 KKAKRSDSMKIKKDAEETLGREAMRKLELIDISDGEEG 98