BLASTX nr result
ID: Mentha25_contig00046068
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00046068 (663 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU27898.1| hypothetical protein MIMGU_mgv1a018665mg, partial... 76 1e-11 ref|XP_002316659.2| hypothetical protein POPTR_0011s04270g [Popu... 60 8e-07 ref|XP_006851884.1| hypothetical protein AMTR_s00041p00121000 [A... 58 2e-06 gb|EYU33488.1| hypothetical protein MIMGU_mgv1a0023121mg, partia... 54 5e-06 gb|EYU43826.1| hypothetical protein MIMGU_mgv1a0029011mg, partia... 54 6e-06 >gb|EYU27898.1| hypothetical protein MIMGU_mgv1a018665mg, partial [Mimulus guttatus] Length = 456 Score = 75.9 bits (185), Expect = 1e-11 Identities = 36/91 (39%), Positives = 55/91 (60%) Frame = -3 Query: 574 DVIKKIFSFLPFKKALHHSIQSKRLRNSWKLCRDLSFKIEVVRNLSRDEYRNIIENFFNN 395 DV+ IFS LP K+ SI S R R SWK CR+LSF +S ++++N + FF + Sbjct: 21 DVLDSIFSHLPIKEVRDLSILSHRFRYSWKFCRNLSFDRHFAGTMSTEKFKNSVNYFFKH 80 Query: 394 QLNTCADRLKFCYEATFEGNLISFW*EKQLN 302 +T AD+ + ++AT + NL+S W +K +N Sbjct: 81 HRSTSADKFRLYFDATNDVNLVSCWTQKAVN 111 >ref|XP_002316659.2| hypothetical protein POPTR_0011s04270g [Populus trichocarpa] gi|550327563|gb|EEE97271.2| hypothetical protein POPTR_0011s04270g [Populus trichocarpa] Length = 495 Score = 59.7 bits (143), Expect = 8e-07 Identities = 29/90 (32%), Positives = 46/90 (51%) Frame = -3 Query: 574 DVIKKIFSFLPFKKALHHSIQSKRLRNSWKLCRDLSFKIEVVRNLSRDEYRNIIENFFNN 395 DV+ IFSFLP KKA+ I S R +NSW R L F + R S +++++I+ F+ Sbjct: 49 DVLDMIFSFLPIKKAMQIGILSTRFKNSWNFNRRLDFDNDFARGRSPEDFKSIVNKVFDR 108 Query: 394 QLNTCADRLKFCYEATFEGNLISFW*EKQL 305 + + C++ E L+ W K + Sbjct: 109 HAGSRILSFRLCFDPNREELLVEKWIRKSI 138 >ref|XP_006851884.1| hypothetical protein AMTR_s00041p00121000 [Amborella trichopoda] gi|548855467|gb|ERN13351.1| hypothetical protein AMTR_s00041p00121000 [Amborella trichopoda] Length = 734 Score = 58.2 bits (139), Expect = 2e-06 Identities = 28/37 (75%), Positives = 30/37 (81%) Frame = -3 Query: 142 FAKSEFAAGFFIVMYVITPISY*TDLYDAKSFPIFSE 32 FA + AAGFFIVMYVITP+SY DLY AK FPIFSE Sbjct: 285 FATANVAAGFFIVMYVITPLSYWLDLYHAKRFPIFSE 321 >gb|EYU33488.1| hypothetical protein MIMGU_mgv1a0023121mg, partial [Mimulus guttatus] Length = 548 Score = 53.9 bits (128), Expect(2) = 5e-06 Identities = 23/37 (62%), Positives = 30/37 (81%) Frame = -3 Query: 142 FAKSEFAAGFFIVMYVITPISY*TDLYDAKSFPIFSE 32 FA + A GFF VMYV+TP+SY ++YDAK+FPIFS+ Sbjct: 303 FATANVAVGFFFVMYVVTPLSYWFNIYDAKTFPIFSD 339 Score = 22.7 bits (47), Expect(2) = 5e-06 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = -2 Query: 56 QVLPYLLRDLFTGAGQIY 3 + P DLFT +GQIY Sbjct: 332 KTFPIFSDDLFTSSGQIY 349 >gb|EYU43826.1| hypothetical protein MIMGU_mgv1a0029011mg, partial [Mimulus guttatus] Length = 425 Score = 53.9 bits (128), Expect(2) = 6e-06 Identities = 23/37 (62%), Positives = 30/37 (81%) Frame = -3 Query: 142 FAKSEFAAGFFIVMYVITPISY*TDLYDAKSFPIFSE 32 FA + A GFF VMYV+TP+SY ++YDAK+FPIFS+ Sbjct: 241 FATANVAVGFFFVMYVVTPLSYWFNIYDAKTFPIFSD 277 Score = 22.7 bits (47), Expect(2) = 6e-06 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = -2 Query: 56 QVLPYLLRDLFTGAGQIY 3 + P DLFT +GQIY Sbjct: 270 KTFPIFSDDLFTSSGQIY 287