BLASTX nr result
ID: Mentha25_contig00044743
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00044743 (381 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU41380.1| hypothetical protein MIMGU_mgv1a003174mg [Mimulus... 60 2e-07 >gb|EYU41380.1| hypothetical protein MIMGU_mgv1a003174mg [Mimulus guttatus] Length = 603 Score = 60.5 bits (145), Expect = 2e-07 Identities = 40/85 (47%), Positives = 47/85 (55%), Gaps = 6/85 (7%) Frame = +3 Query: 144 AAASPSPCTPFLNHQVHHHDHTRRRIFHRTSMWSSNIMKNQLISKFRGAQSAKASPLD-- 317 AAAS SPCTP NHQ H + + S SN KN+ I KF G QS K SP + Sbjct: 5 AAASLSPCTPIQNHQ----RHIQSKFIPCCSFSRSNFNKNRSIGKFVGIQSLKISPFEGN 60 Query: 318 ----EELNVNGETGLAEIEASSAVK 380 ++NV GET A IEAS+AVK Sbjct: 61 NRPGNKINVLGETENAGIEASNAVK 85