BLASTX nr result
ID: Mentha25_contig00044534
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00044534 (356 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU41978.1| hypothetical protein MIMGU_mgv1a000202mg [Mimulus... 74 2e-11 >gb|EYU41978.1| hypothetical protein MIMGU_mgv1a000202mg [Mimulus guttatus] Length = 1439 Score = 74.3 bits (181), Expect = 2e-11 Identities = 40/89 (44%), Positives = 53/89 (59%), Gaps = 1/89 (1%) Frame = -3 Query: 333 PGYPKNPLSSIAPPSNPFLQENQKNLSDXXXXXXXXPVQWRMGKLQHAPPSSEEEMLRNE 154 PGY +P I PPSNPF + NQ NLSD PVQWRM KLQHA S+E ++++++ Sbjct: 1089 PGYSVDPFDFIYPPSNPFSEANQINLSDLPPLPPLPPVQWRMTKLQHASSSTEGQIMKHK 1148 Query: 153 ESFPQSFS-TTAAADDGSSPPTASTNDGI 70 FP S TA+ +D + PP + D I Sbjct: 1149 GLFPPLISPITASTNDVAYPPPTISTDSI 1177