BLASTX nr result
ID: Mentha25_contig00044456
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00044456 (960 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006414773.1| hypothetical protein EUTSA_v10027085mg, part... 57 8e-06 >ref|XP_006414773.1| hypothetical protein EUTSA_v10027085mg, partial [Eutrema salsugineum] gi|557115943|gb|ESQ56226.1| hypothetical protein EUTSA_v10027085mg, partial [Eutrema salsugineum] Length = 405 Score = 57.4 bits (137), Expect = 8e-06 Identities = 33/105 (31%), Positives = 51/105 (48%) Frame = +3 Query: 3 QLSLT*VGILELIVLGFDPSNSKIPDWVWTLVEDAEEWDKFPWGSMSYQILSRSIMNVKR 182 +L L + ++ +V+ IP LV D E+ K+PWG +++ L SI V+ Sbjct: 58 RLRLVYLYVIASLVMAKSNKTINIPKEYIILVMDLEKLRKYPWGRVAFDFLVESIKKVRV 117 Query: 183 KLGTHKGYHLHGNTLALMGWIYTAFPDLGRDIGGLREDIALGSPR 317 KL GY L+G ++A WI A P LG + +D+ G R Sbjct: 118 KLTQSTGYALNGFSIAFQIWIMEAIPVLGHMLSSRLDDVIAGVAR 162