BLASTX nr result
ID: Mentha25_contig00044081
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00044081 (365 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU43934.1| hypothetical protein MIMGU_mgv1a009865mg [Mimulus... 92 1e-16 ref|XP_002272682.1| PREDICTED: mitochondrial thiamine pyrophosph... 91 1e-16 ref|XP_006349808.1| PREDICTED: mitochondrial thiamine pyrophosph... 91 2e-16 ref|XP_002314452.2| mitochondrial substrate carrier family prote... 91 2e-16 ref|XP_007222579.1| hypothetical protein PRUPE_ppa008444mg [Prun... 90 4e-16 ref|XP_006342787.1| PREDICTED: mitochondrial thiamine pyrophosph... 89 8e-16 ref|XP_006855518.1| hypothetical protein AMTR_s00057p00207420 [A... 89 8e-16 ref|XP_004229228.1| PREDICTED: mitochondrial thiamine pyrophosph... 89 8e-16 ref|XP_006389228.1| mitochondrial substrate carrier family prote... 88 1e-15 ref|XP_006389227.1| hypothetical protein POPTR_0034s00220g [Popu... 88 1e-15 ref|XP_002516904.1| Mitochondrial deoxynucleotide carrier, putat... 88 1e-15 ref|XP_007035559.1| Mitochondrial substrate carrier family prote... 88 1e-15 ref|XP_007138898.1| hypothetical protein PHAVU_009G246900g [Phas... 87 2e-15 ref|XP_004487886.1| PREDICTED: mitochondrial thiamine pyrophosph... 87 2e-15 ref|XP_006848889.1| hypothetical protein AMTR_s00161p00018520 [A... 86 4e-15 ref|XP_006419608.1| hypothetical protein CICLE_v10005390mg [Citr... 86 7e-15 ref|XP_006419607.1| hypothetical protein CICLE_v10005390mg [Citr... 86 7e-15 ref|XP_006419605.1| hypothetical protein CICLE_v10005390mg [Citr... 86 7e-15 ref|XP_004296825.1| PREDICTED: mitochondrial thiamine pyrophosph... 85 1e-14 ref|XP_004172379.1| PREDICTED: mitochondrial thiamine pyrophosph... 84 2e-14 >gb|EYU43934.1| hypothetical protein MIMGU_mgv1a009865mg [Mimulus guttatus] Length = 329 Score = 91.7 bits (226), Expect = 1e-16 Identities = 43/51 (84%), Positives = 46/51 (90%) Frame = -2 Query: 364 MYDALCQILHREGWAGLYKGITPSIVKAAPAGAVTFVAYEFTSDWLESLLT 212 MYDAL +I+ EGWAGLYKGI PSIVKAAPAGAVTFVAYEFTSDWLES+ T Sbjct: 279 MYDALTRIMQAEGWAGLYKGIVPSIVKAAPAGAVTFVAYEFTSDWLESVST 329 >ref|XP_002272682.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier [Vitis vinifera] gi|297736865|emb|CBI26066.3| unnamed protein product [Vitis vinifera] Length = 330 Score = 91.3 bits (225), Expect = 1e-16 Identities = 43/51 (84%), Positives = 47/51 (92%) Frame = -2 Query: 364 MYDALCQILHREGWAGLYKGITPSIVKAAPAGAVTFVAYEFTSDWLESLLT 212 MYDAL QIL EGWAGLYKGI PSI+K+APAGAVTFVAYEFTSDWLES++T Sbjct: 280 MYDALRQILLVEGWAGLYKGIVPSIIKSAPAGAVTFVAYEFTSDWLESMVT 330 >ref|XP_006349808.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier-like [Solanum tuberosum] Length = 329 Score = 90.9 bits (224), Expect = 2e-16 Identities = 43/51 (84%), Positives = 46/51 (90%) Frame = -2 Query: 364 MYDALCQILHREGWAGLYKGITPSIVKAAPAGAVTFVAYEFTSDWLESLLT 212 MYD L +IL EGWAGLYKGI PSIVKAAPAGAVTFVAYE+TSDWLES+LT Sbjct: 279 MYDGLRRILLEEGWAGLYKGIVPSIVKAAPAGAVTFVAYEYTSDWLESILT 329 >ref|XP_002314452.2| mitochondrial substrate carrier family protein [Populus trichocarpa] gi|550328947|gb|EEF00623.2| mitochondrial substrate carrier family protein [Populus trichocarpa] Length = 341 Score = 90.9 bits (224), Expect = 2e-16 Identities = 43/51 (84%), Positives = 46/51 (90%) Frame = -2 Query: 364 MYDALCQILHREGWAGLYKGITPSIVKAAPAGAVTFVAYEFTSDWLESLLT 212 M+DAL +IL EGWAGLYKGI PS VKAAPAGAVTFVAYEFTSDWLES+LT Sbjct: 291 MFDALRRILQTEGWAGLYKGIVPSTVKAAPAGAVTFVAYEFTSDWLESILT 341 >ref|XP_007222579.1| hypothetical protein PRUPE_ppa008444mg [Prunus persica] gi|462419515|gb|EMJ23778.1| hypothetical protein PRUPE_ppa008444mg [Prunus persica] Length = 331 Score = 89.7 bits (221), Expect = 4e-16 Identities = 42/51 (82%), Positives = 46/51 (90%) Frame = -2 Query: 364 MYDALCQILHREGWAGLYKGITPSIVKAAPAGAVTFVAYEFTSDWLESLLT 212 M+DAL +IL +EGWAGLYKGI PS VKAAPAGAVTFVAYE+TSDWLES LT Sbjct: 281 MFDALRRILQKEGWAGLYKGIVPSTVKAAPAGAVTFVAYEYTSDWLESALT 331 >ref|XP_006342787.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier-like [Solanum tuberosum] Length = 331 Score = 88.6 bits (218), Expect = 8e-16 Identities = 41/51 (80%), Positives = 45/51 (88%) Frame = -2 Query: 364 MYDALCQILHREGWAGLYKGITPSIVKAAPAGAVTFVAYEFTSDWLESLLT 212 MYD L +IL EGWAGLYKGI PS++KAAPAGAVTFVAYE+TSDWLES LT Sbjct: 281 MYDGLRRILIEEGWAGLYKGIVPSVIKAAPAGAVTFVAYEYTSDWLESKLT 331 >ref|XP_006855518.1| hypothetical protein AMTR_s00057p00207420 [Amborella trichopoda] gi|548859284|gb|ERN16985.1| hypothetical protein AMTR_s00057p00207420 [Amborella trichopoda] Length = 369 Score = 88.6 bits (218), Expect = 8e-16 Identities = 41/51 (80%), Positives = 46/51 (90%) Frame = -2 Query: 364 MYDALCQILHREGWAGLYKGITPSIVKAAPAGAVTFVAYEFTSDWLESLLT 212 M+DAL I+ EGWAGLYKGI PSI+KAAPAGAVTFVAYE+TSDWLES+LT Sbjct: 319 MWDALRGIVQAEGWAGLYKGIVPSIIKAAPAGAVTFVAYEYTSDWLESILT 369 >ref|XP_004229228.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier-like [Solanum lycopersicum] Length = 331 Score = 88.6 bits (218), Expect = 8e-16 Identities = 41/51 (80%), Positives = 45/51 (88%) Frame = -2 Query: 364 MYDALCQILHREGWAGLYKGITPSIVKAAPAGAVTFVAYEFTSDWLESLLT 212 MYD L +IL EGWAGLYKGI PS++KAAPAGAVTFVAYE+TSDWLES LT Sbjct: 281 MYDGLRRILIEEGWAGLYKGIVPSVIKAAPAGAVTFVAYEYTSDWLESKLT 331 >ref|XP_006389228.1| mitochondrial substrate carrier family protein [Populus trichocarpa] gi|550311967|gb|ERP48142.1| mitochondrial substrate carrier family protein [Populus trichocarpa] Length = 342 Score = 88.2 bits (217), Expect = 1e-15 Identities = 41/51 (80%), Positives = 45/51 (88%) Frame = -2 Query: 364 MYDALCQILHREGWAGLYKGITPSIVKAAPAGAVTFVAYEFTSDWLESLLT 212 M+DAL +IL EGWAGLYKGI PS VKAAPAGAVTF+AYEFTSDWLES+ T Sbjct: 292 MFDALSRILQMEGWAGLYKGIVPSTVKAAPAGAVTFLAYEFTSDWLESIST 342 >ref|XP_006389227.1| hypothetical protein POPTR_0034s00220g [Populus trichocarpa] gi|550311966|gb|ERP48141.1| hypothetical protein POPTR_0034s00220g [Populus trichocarpa] Length = 305 Score = 88.2 bits (217), Expect = 1e-15 Identities = 41/51 (80%), Positives = 45/51 (88%) Frame = -2 Query: 364 MYDALCQILHREGWAGLYKGITPSIVKAAPAGAVTFVAYEFTSDWLESLLT 212 M+DAL +IL EGWAGLYKGI PS VKAAPAGAVTF+AYEFTSDWLES+ T Sbjct: 255 MFDALSRILQMEGWAGLYKGIVPSTVKAAPAGAVTFLAYEFTSDWLESIST 305 >ref|XP_002516904.1| Mitochondrial deoxynucleotide carrier, putative [Ricinus communis] gi|223543992|gb|EEF45518.1| Mitochondrial deoxynucleotide carrier, putative [Ricinus communis] Length = 331 Score = 88.2 bits (217), Expect = 1e-15 Identities = 42/51 (82%), Positives = 45/51 (88%) Frame = -2 Query: 364 MYDALCQILHREGWAGLYKGITPSIVKAAPAGAVTFVAYEFTSDWLESLLT 212 M DAL +IL EGWAGLYKGI PS +KAAPAGAVTFVAYEFTSDWLES+LT Sbjct: 281 MADALRRILQAEGWAGLYKGILPSTIKAAPAGAVTFVAYEFTSDWLESILT 331 >ref|XP_007035559.1| Mitochondrial substrate carrier family protein [Theobroma cacao] gi|508714588|gb|EOY06485.1| Mitochondrial substrate carrier family protein [Theobroma cacao] Length = 330 Score = 87.8 bits (216), Expect = 1e-15 Identities = 41/51 (80%), Positives = 45/51 (88%) Frame = -2 Query: 364 MYDALCQILHREGWAGLYKGITPSIVKAAPAGAVTFVAYEFTSDWLESLLT 212 M+DAL +IL EGW GLYKGI PS +KAAPAGAVTFVAYEFTSDWLES+LT Sbjct: 280 MFDALRRILQLEGWHGLYKGIVPSTIKAAPAGAVTFVAYEFTSDWLESILT 330 >ref|XP_007138898.1| hypothetical protein PHAVU_009G246900g [Phaseolus vulgaris] gi|561011985|gb|ESW10892.1| hypothetical protein PHAVU_009G246900g [Phaseolus vulgaris] Length = 328 Score = 87.4 bits (215), Expect = 2e-15 Identities = 41/51 (80%), Positives = 45/51 (88%) Frame = -2 Query: 364 MYDALCQILHREGWAGLYKGITPSIVKAAPAGAVTFVAYEFTSDWLESLLT 212 M+DA+ +IL +EGWAGLYKGI PS VKAAPA AVTFVAYE TSDWLESLLT Sbjct: 278 MFDAIKRILQKEGWAGLYKGIVPSTVKAAPANAVTFVAYELTSDWLESLLT 328 >ref|XP_004487886.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier-like [Cicer arietinum] Length = 333 Score = 87.0 bits (214), Expect = 2e-15 Identities = 41/51 (80%), Positives = 44/51 (86%) Frame = -2 Query: 364 MYDALCQILHREGWAGLYKGITPSIVKAAPAGAVTFVAYEFTSDWLESLLT 212 M+D L +IL EGWAGLYKGI PS VKAAPAGAVTFVAYE TSDWLES+LT Sbjct: 283 MFDGLRRILQMEGWAGLYKGIVPSTVKAAPAGAVTFVAYELTSDWLESILT 333 >ref|XP_006848889.1| hypothetical protein AMTR_s00161p00018520 [Amborella trichopoda] gi|548852342|gb|ERN10470.1| hypothetical protein AMTR_s00161p00018520 [Amborella trichopoda] Length = 83 Score = 86.3 bits (212), Expect = 4e-15 Identities = 40/51 (78%), Positives = 45/51 (88%) Frame = -2 Query: 364 MYDALCQILHREGWAGLYKGITPSIVKAAPAGAVTFVAYEFTSDWLESLLT 212 M+DAL I+ EGWAGLYKGI PSI+KAA AGAVTFVAYE+TSDWLES+LT Sbjct: 33 MWDALHSIVQAEGWAGLYKGIVPSIIKAASAGAVTFVAYEYTSDWLESILT 83 >ref|XP_006419608.1| hypothetical protein CICLE_v10005390mg [Citrus clementina] gi|557521481|gb|ESR32848.1| hypothetical protein CICLE_v10005390mg [Citrus clementina] Length = 268 Score = 85.5 bits (210), Expect = 7e-15 Identities = 40/51 (78%), Positives = 44/51 (86%) Frame = -2 Query: 364 MYDALCQILHREGWAGLYKGITPSIVKAAPAGAVTFVAYEFTSDWLESLLT 212 M DAL +I+ EGWAGLYKGI PS VKAAPAGAVTFVAYE+ SDWLES+LT Sbjct: 218 MSDALSRIVQAEGWAGLYKGIVPSTVKAAPAGAVTFVAYEYASDWLESILT 268 >ref|XP_006419607.1| hypothetical protein CICLE_v10005390mg [Citrus clementina] gi|568871878|ref|XP_006489106.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier-like [Citrus sinensis] gi|557521480|gb|ESR32847.1| hypothetical protein CICLE_v10005390mg [Citrus clementina] Length = 333 Score = 85.5 bits (210), Expect = 7e-15 Identities = 40/51 (78%), Positives = 44/51 (86%) Frame = -2 Query: 364 MYDALCQILHREGWAGLYKGITPSIVKAAPAGAVTFVAYEFTSDWLESLLT 212 M DAL +I+ EGWAGLYKGI PS VKAAPAGAVTFVAYE+ SDWLES+LT Sbjct: 283 MSDALSRIVQAEGWAGLYKGIVPSTVKAAPAGAVTFVAYEYASDWLESILT 333 >ref|XP_006419605.1| hypothetical protein CICLE_v10005390mg [Citrus clementina] gi|557521478|gb|ESR32845.1| hypothetical protein CICLE_v10005390mg [Citrus clementina] Length = 241 Score = 85.5 bits (210), Expect = 7e-15 Identities = 40/51 (78%), Positives = 44/51 (86%) Frame = -2 Query: 364 MYDALCQILHREGWAGLYKGITPSIVKAAPAGAVTFVAYEFTSDWLESLLT 212 M DAL +I+ EGWAGLYKGI PS VKAAPAGAVTFVAYE+ SDWLES+LT Sbjct: 191 MSDALSRIVQAEGWAGLYKGIVPSTVKAAPAGAVTFVAYEYASDWLESILT 241 >ref|XP_004296825.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier-like [Fragaria vesca subsp. vesca] Length = 330 Score = 84.7 bits (208), Expect = 1e-14 Identities = 40/50 (80%), Positives = 44/50 (88%) Frame = -2 Query: 364 MYDALCQILHREGWAGLYKGITPSIVKAAPAGAVTFVAYEFTSDWLESLL 215 M DAL +I+ +EGWAGLYKGI PS VKAAPAGAVTFVAYE+TSDWLES L Sbjct: 281 MVDALRRIVQKEGWAGLYKGIVPSTVKAAPAGAVTFVAYEYTSDWLESRL 330 >ref|XP_004172379.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier-like, partial [Cucumis sativus] Length = 219 Score = 84.0 bits (206), Expect = 2e-14 Identities = 41/51 (80%), Positives = 45/51 (88%) Frame = -2 Query: 364 MYDALCQILHREGWAGLYKGITPSIVKAAPAGAVTFVAYEFTSDWLESLLT 212 M+DAL +IL +EG AGLYKGI PS VKAAPAGAVTFVAYE TSDWLES+LT Sbjct: 165 MFDALRRILKKEGTAGLYKGIIPSTVKAAPAGAVTFVAYEITSDWLESILT 215