BLASTX nr result
ID: Mentha25_contig00043297
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00043297 (485 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU46796.1| hypothetical protein MIMGU_mgv1a002033mg [Mimulus... 101 1e-19 >gb|EYU46796.1| hypothetical protein MIMGU_mgv1a002033mg [Mimulus guttatus] Length = 724 Score = 101 bits (251), Expect = 1e-19 Identities = 47/62 (75%), Positives = 54/62 (87%), Gaps = 1/62 (1%) Frame = +2 Query: 302 MDALWFKAGIHAMAAPPIAAV-NGEVRLSDRPSVSAAQPKNSPWGFTFRHPLRSLWPGGK 478 MDAL FKAGIH M A PIAA NG++RLS++PSVSA+Q +N PWG+TFRHPLRSLWPGGK Sbjct: 1 MDALCFKAGIHGMVAQPIAAAGNGDLRLSEKPSVSASQNRNLPWGYTFRHPLRSLWPGGK 60 Query: 479 NR 484 NR Sbjct: 61 NR 62