BLASTX nr result
ID: Mentha25_contig00043115
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00043115 (518 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCU83098.1| putative Bgh-specific protein [Blumeria graminis... 73 5e-11 gb|EPQ66995.1| hypothetical protein BGT96224_5475 [Blumeria gram... 72 8e-11 >emb|CCU83098.1| putative Bgh-specific protein [Blumeria graminis f. sp. hordei DH14] Length = 607 Score = 72.8 bits (177), Expect = 5e-11 Identities = 39/63 (61%), Positives = 46/63 (73%) Frame = +1 Query: 307 PPRQIESSSVSPLVFGTGTAKLARSFSGAGIERACIVRCSSPSQYSLTTPTAKTHSLLLS 486 P + ES S SPLVFGTGTAKLARSFSGAGIE+A IVRCS+P+ PT++ +L S Sbjct: 303 PKKLGESPSASPLVFGTGTAKLARSFSGAGIEKAHIVRCSTPNLLPGPAPTSRLPNLPAS 362 Query: 487 RPT 495 R T Sbjct: 363 RST 365 >gb|EPQ66995.1| hypothetical protein BGT96224_5475 [Blumeria graminis f. sp. tritici 96224] Length = 608 Score = 72.0 bits (175), Expect = 8e-11 Identities = 37/63 (58%), Positives = 46/63 (73%) Frame = +1 Query: 307 PPRQIESSSVSPLVFGTGTAKLARSFSGAGIERACIVRCSSPSQYSLTTPTAKTHSLLLS 486 P + E+ S SPLVFGTGTAKLARSFSGAG+E+A IVRCS+P+ PT++ +L S Sbjct: 304 PKKAGEAPSASPLVFGTGTAKLARSFSGAGVEKAHIVRCSTPNLLPGPAPTSRLPNLSAS 363 Query: 487 RPT 495 R T Sbjct: 364 RST 366