BLASTX nr result
ID: Mentha25_contig00043049
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00043049 (364 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU31281.1| hypothetical protein MIMGU_mgv1a011604mg [Mimulus... 70 2e-10 >gb|EYU31281.1| hypothetical protein MIMGU_mgv1a011604mg [Mimulus guttatus] Length = 276 Score = 70.5 bits (171), Expect = 2e-10 Identities = 37/77 (48%), Positives = 44/77 (57%), Gaps = 4/77 (5%) Frame = +3 Query: 144 MSLVSCSGNQCPFNYTARSSNGQSSNDLKSFAAVPHLGWGQRRDK----SRNNRRMSSIT 311 M L+SCS N C + +S S LKS + PHLGWG+RR S N S Sbjct: 1 MILLSCSSNHCSLSSNVMASAAAPSTILKSSSIFPHLGWGRRRRSCNLPSINRGVSKSTV 60 Query: 312 AYYGLKKPPYELDALEP 362 AYYGL+ PPY+LDALEP Sbjct: 61 AYYGLRSPPYKLDALEP 77