BLASTX nr result
ID: Mentha25_contig00042118
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00042118 (353 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU18487.1| hypothetical protein MIMGU_mgv1a025371mg, partial... 83 5e-14 >gb|EYU18487.1| hypothetical protein MIMGU_mgv1a025371mg, partial [Mimulus guttatus] Length = 623 Score = 82.8 bits (203), Expect = 5e-14 Identities = 41/74 (55%), Positives = 52/74 (70%) Frame = +1 Query: 19 SPWISDKAGSVVSFVNGPAILNGEDSYTPKEQMNEHPKQVKLQKQSVEELKEHNFGNGSL 198 S W S+K+ S +SFVNGPA+ N ED + P++QM +H KQVKLQ QS + KEH FG+ S Sbjct: 287 SSWTSEKSDSCMSFVNGPAMANSEDGFIPRQQMMDHKKQVKLQNQSTGKRKEHYFGDNS- 345 Query: 199 DCTSKLPNEAVQLP 240 + S L NE VQLP Sbjct: 346 NYMSNLSNEVVQLP 359