BLASTX nr result
ID: Mentha25_contig00042022
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00042022 (361 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_949642.1| hypothetical protein AAur_3970 [Arthrobacter au... 76 6e-12 ref|WP_009372954.1| hypothetical protein [Arthrobacter sp. SJCon... 74 3e-11 ref|WP_006143789.1| photosystem reaction center subunit H [Strep... 70 2e-10 ref|WP_003080252.1| hypothetical protein [Amycolatopsis vancores... 70 4e-10 ref|YP_003382284.1| PRC-barrel domain-containing protein [Kribbe... 70 4e-10 ref|WP_017198868.1| photosystem reaction center subunit H [Arthr... 69 5e-10 ref|YP_006265781.1| hypothetical protein ACPL_2818 [Actinoplanes... 69 7e-10 ref|WP_003800562.1| photosystem reaction center subunit H [Arthr... 69 9e-10 ref|WP_019330442.1| hypothetical protein, partial [Streptomyces ... 68 1e-09 ref|WP_020124717.1| hypothetical protein [Streptomyces canus] 68 2e-09 ref|YP_003770184.1| hypothetical protein AMED_8079 [Amycolatopsi... 68 2e-09 ref|WP_022925113.1| photosystem reaction center subunit H [Serin... 67 2e-09 ref|WP_005266077.1| hypothetical protein [Arthrobacter crystallo... 67 3e-09 ref|WP_020500216.1| hypothetical protein [Sciscionella marina] 67 3e-09 ref|WP_003802769.1| photosystem reaction center subunit H [Arthr... 67 3e-09 ref|WP_007443199.1| hypothetical protein, partial [Streptomyces ... 66 4e-09 ref|WP_005160664.1| hypothetical protein [Amycolatopsis azurea] ... 66 6e-09 ref|NP_625217.1| hypothetical protein SCO0919 [Streptomyces coel... 65 8e-09 ref|YP_006367916.1| hypothetical protein MODMU_4039 [Modestobact... 65 8e-09 ref|WP_003977940.1| photosystem reaction center subunit H [Strep... 65 8e-09 >ref|YP_949642.1| hypothetical protein AAur_3970 [Arthrobacter aurescens TC1] gi|403529133|ref|YP_006664020.1| hypothetical protein ARUE_c41100 [Arthrobacter sp. Rue61a] gi|500100560|ref|WP_011776567.1| photosystem reaction center subunit H [Arthrobacter] gi|119949811|gb|ABM08722.1| putative conserved domain protein [Arthrobacter aurescens TC1] gi|403231560|gb|AFR30982.1| hypothetical protein ARUE_c41100 [Arthrobacter sp. Rue61a] Length = 282 Score = 75.9 bits (185), Expect = 6e-12 Identities = 42/76 (55%), Positives = 51/76 (67%), Gaps = 3/76 (3%) Frame = -1 Query: 292 GDAYMTRSEERLLVGKEQVGAGVASLNKYVTSEHVHTAVPITREHVVIEREPIT---AAD 122 GD MTRSEERL VG E+ G A L KY+T+E+V T VP+ RE V +EREPIT A D Sbjct: 156 GDDAMTRSEERLNVGTEKQATGRARLRKYITTENVTTTVPVQREEVRLEREPITDANAGD 215 Query: 121 GIRGAEIKEAHIEVAL 74 + GAE+ E+ EV L Sbjct: 216 AMSGAELTESEHEVTL 231 >ref|WP_009372954.1| hypothetical protein [Arthrobacter sp. SJCon] gi|443481527|gb|ELT44451.1| hypothetical protein G205_11975 [Arthrobacter sp. SJCon] Length = 286 Score = 73.6 bits (179), Expect = 3e-11 Identities = 42/75 (56%), Positives = 49/75 (65%), Gaps = 3/75 (4%) Frame = -1 Query: 289 DAYMTRSEERLLVGKEQVGAGVASLNKYVTSEHVHTAVPITREHVVIEREPITAA---DG 119 D MTRSEERL VG E+ AG A L KYVT+EHV VP+ RE V +EREP+T A D Sbjct: 162 DDAMTRSEERLHVGTERETAGRARLRKYVTTEHVTKTVPVQREEVRLEREPVTDANRGDA 221 Query: 118 IRGAEIKEAHIEVAL 74 +RG +I E EV L Sbjct: 222 MRGPDISEEEHEVTL 236 >ref|WP_006143789.1| photosystem reaction center subunit H [Streptomyces griseoaurantiacus] gi|329299674|gb|EGG43573.1| hypothetical protein SGM_5914 [Streptomyces griseoaurantiacus M045] Length = 347 Score = 70.5 bits (171), Expect = 2e-10 Identities = 41/76 (53%), Positives = 47/76 (61%), Gaps = 3/76 (3%) Frame = -1 Query: 292 GDAYMTRSEERLLVGKEQVGAGVASLNKYVTSEHVHTAVPITREHVVIEREPITAA---D 122 GD MTRSEER+ VG E+ G A L KYV +E V VP+ E V IEREPIT A D Sbjct: 213 GDDAMTRSEERMHVGVERRETGRARLRKYVVTEDVEQTVPLRHEEVRIEREPITDANRGD 272 Query: 121 GIRGAEIKEAHIEVAL 74 +RG EI EA E+ L Sbjct: 273 AVRGPEISEAEYELTL 288 >ref|WP_003080252.1| hypothetical protein [Amycolatopsis vancoresmycina] gi|486085434|gb|EOD67777.1| hypothetical protein H480_14807 [Amycolatopsis vancoresmycina DSM 44592] Length = 253 Score = 69.7 bits (169), Expect = 4e-10 Identities = 41/72 (56%), Positives = 45/72 (62%) Frame = -1 Query: 289 DAYMTRSEERLLVGKEQVGAGVASLNKYVTSEHVHTAVPITREHVVIEREPITAADGIRG 110 D MTRSEERL VG EQV AG L KYV +E VP+ E V IEREP+T ADG Sbjct: 133 DRSMTRSEERLNVGTEQVEAGHVRLRKYVVTEEQQVTVPVRHEEVRIEREPVTRADG--R 190 Query: 109 AEIKEAHIEVAL 74 AEI EA +V L Sbjct: 191 AEIGEAEQDVVL 202 >ref|YP_003382284.1| PRC-barrel domain-containing protein [Kribbella flavida DSM 17836] gi|502686489|ref|WP_012922039.1| photosystem reaction center subunit H [Kribbella flavida] gi|283811646|gb|ADB33485.1| PRC-barrel domain protein [Kribbella flavida DSM 17836] Length = 269 Score = 69.7 bits (169), Expect = 4e-10 Identities = 39/75 (52%), Positives = 46/75 (61%), Gaps = 3/75 (4%) Frame = -1 Query: 289 DAYMTRSEERLLVGKEQVGAGVASLNKYVTSEHVHTAVPITREHVVIEREPITAA---DG 119 D MTRSEERL VG ++ AG L KYV +EHV T VP+ +E V+EREPIT A D Sbjct: 146 DDAMTRSEERLDVGTQRQEAGRVRLRKYVETEHVQTTVPVQKERAVVEREPITDANVGDA 205 Query: 118 IRGAEIKEAHIEVAL 74 G EI E E+ L Sbjct: 206 TSGPEISEEEHEIVL 220 >ref|WP_017198868.1| photosystem reaction center subunit H [Arthrobacter sp. M2012083] Length = 276 Score = 69.3 bits (168), Expect = 5e-10 Identities = 38/76 (50%), Positives = 50/76 (65%), Gaps = 3/76 (3%) Frame = -1 Query: 292 GDAYMTRSEERLLVGKEQVGAGVASLNKYVTSEHVHTAVPITREHVVIEREPIT---AAD 122 GD MTRSEE+L VG E+ G A L KY+T+E+V T VP+ RE V +EREPIT A + Sbjct: 150 GDDAMTRSEEQLNVGTERQATGRARLRKYITTENVTTTVPVQREEVRLEREPITDANAGN 209 Query: 121 GIRGAEIKEAHIEVAL 74 + G ++ E+ EV L Sbjct: 210 AMSGPDLTESEHEVTL 225 >ref|YP_006265781.1| hypothetical protein ACPL_2818 [Actinoplanes sp. SE50/110] gi|504502683|ref|WP_014689785.1| photosystem reaction center subunit H [Actinoplanes sp. SE50/110] gi|359835272|gb|AEV83713.1| uncharacterized protein ACPL_2818 [Actinoplanes sp. SE50/110] Length = 285 Score = 68.9 bits (167), Expect = 7e-10 Identities = 38/76 (50%), Positives = 48/76 (63%), Gaps = 3/76 (3%) Frame = -1 Query: 292 GDAYMTRSEERLLVGKEQVGAGVASLNKYVTSEHVHTAVPITREHVVIEREPITAAD--- 122 GD MTRSEERL VG E+ G A L KYVT+E +VP+TRE V +EREP+T A+ Sbjct: 157 GDDAMTRSEERLTVGTERERTGKARLRKYVTTEQQQVSVPVTREEVRLEREPVTDANRDA 216 Query: 121 GIRGAEIKEAHIEVAL 74 G ++ E+ EV L Sbjct: 217 AFSGPDLTESEHEVTL 232 >ref|WP_003800562.1| photosystem reaction center subunit H [Arthrobacter globiformis] gi|359306683|dbj|GAB13389.1| hypothetical protein ARGLB_037_02400 [Arthrobacter globiformis NBRC 12137] Length = 276 Score = 68.6 bits (166), Expect = 9e-10 Identities = 41/75 (54%), Positives = 48/75 (64%), Gaps = 3/75 (4%) Frame = -1 Query: 289 DAYMTRSEERLLVGKEQVGAGVASLNKYVTSEHVHTAVPITREHVVIEREPITAAD---G 119 D MTRSEERL VG E+ AG A L KYVT+E+V VP+ RE V IEREPIT A+ Sbjct: 153 DDAMTRSEERLNVGTERHAAGRARLRKYVTTENVTKTVPVQREEVRIEREPITDANRGAA 212 Query: 118 IRGAEIKEAHIEVAL 74 + G +I E EV L Sbjct: 213 LSGPDISEEEHEVTL 227 >ref|WP_019330442.1| hypothetical protein, partial [Streptomyces sp. TOR3209] Length = 151 Score = 68.2 bits (165), Expect = 1e-09 Identities = 39/76 (51%), Positives = 48/76 (63%), Gaps = 3/76 (3%) Frame = -1 Query: 292 GDAYMTRSEERLLVGKEQVGAGVASLNKYVTSEHVHTAVPITREHVVIEREPITAA---D 122 GD MTRSEE++ VG E+ +G A L KYV +E V VP++ E V +EREPIT A D Sbjct: 14 GDDAMTRSEEQMHVGVERRESGRARLRKYVVTEEVQQTVPVSHEEVRVEREPITDANRGD 73 Query: 121 GIRGAEIKEAHIEVAL 74 + G EI EA EV L Sbjct: 74 ALAGPEISEAEHEVTL 89 >ref|WP_020124717.1| hypothetical protein [Streptomyces canus] Length = 268 Score = 67.8 bits (164), Expect = 2e-09 Identities = 39/76 (51%), Positives = 48/76 (63%), Gaps = 3/76 (3%) Frame = -1 Query: 292 GDAYMTRSEERLLVGKEQVGAGVASLNKYVTSEHVHTAVPITREHVVIEREPITAAD--- 122 GD MTRSEER+ VG E+ AG A L KYV +E V VP+ E V +EREPIT A+ Sbjct: 142 GDDAMTRSEERMHVGTERREAGRARLRKYVVTEEVQQTVPVRHEEVRVEREPITDANRDA 201 Query: 121 GIRGAEIKEAHIEVAL 74 + G++I EA EV L Sbjct: 202 ALSGSDITEAEHEVTL 217 >ref|YP_003770184.1| hypothetical protein AMED_8079 [Amycolatopsis mediterranei U32] gi|384153409|ref|YP_005536225.1| hypothetical protein RAM_41505 [Amycolatopsis mediterranei S699] gi|399541773|ref|YP_006554435.1| hypothetical protein AMES_7957 [Amycolatopsis mediterranei S699] gi|532464635|ref|YP_008464287.1| hypothetical protein B737_7958 [Amycolatopsis mediterranei RB] gi|502994837|ref|WP_013229813.1| hypothetical protein [Amycolatopsis mediterranei] gi|299799407|gb|ADJ49782.1| conserved hypothetical protein [Amycolatopsis mediterranei U32] gi|340531563|gb|AEK46768.1| hypothetical protein RAM_41505 [Amycolatopsis mediterranei S699] gi|398322543|gb|AFO81490.1| hypothetical protein AMES_7957 [Amycolatopsis mediterranei S699] gi|532233640|gb|AGT88619.1| hypothetical protein B737_7958 [Amycolatopsis mediterranei RB] Length = 253 Score = 67.8 bits (164), Expect = 2e-09 Identities = 40/71 (56%), Positives = 44/71 (61%) Frame = -1 Query: 286 AYMTRSEERLLVGKEQVGAGVASLNKYVTSEHVHTAVPITREHVVIEREPITAADGIRGA 107 A MTRSEERL VG EQV G L KYV +E VP+ E V +EREPIT ADG A Sbjct: 134 AAMTRSEERLNVGTEQVETGHVRLRKYVVTEEQQVTVPVRHEEVRVEREPITRADGT--A 191 Query: 106 EIKEAHIEVAL 74 EI EA +V L Sbjct: 192 EIGEAEQDVIL 202 >ref|WP_022925113.1| photosystem reaction center subunit H [Serinicoccus marinus] Length = 283 Score = 67.4 bits (163), Expect = 2e-09 Identities = 39/76 (51%), Positives = 47/76 (61%), Gaps = 2/76 (2%) Frame = -1 Query: 295 EGDAYMTRSEERLLVGKEQVGAGVASLNKYVTSEHVHTAVPITREHVVIEREPITAADGI 116 + DA M RSEE+L VG E+V G A L KYV +EHV VP+ RE V IEREP+ D Sbjct: 158 DSDASMVRSEEQLNVGTEKVTTGKARLRKYVVTEHVTKTVPVQREEVRIEREPLDKQDRD 217 Query: 115 R--GAEIKEAHIEVAL 74 R GA++ E EV L Sbjct: 218 RLSGADLAEDEQEVTL 233 >ref|WP_005266077.1| hypothetical protein [Arthrobacter crystallopoietes] gi|476403187|gb|EMY36257.1| hypothetical protein D477_000075 [Arthrobacter crystallopoietes BAB-32] Length = 277 Score = 67.0 bits (162), Expect = 3e-09 Identities = 39/75 (52%), Positives = 46/75 (61%), Gaps = 3/75 (4%) Frame = -1 Query: 289 DAYMTRSEERLLVGKEQVGAGVASLNKYVTSEHVHTAVPITREHVVIEREPITAA---DG 119 D MTRSEERL VG E G A L KYV +E+V VP+T E V +EREPIT A + Sbjct: 153 DDAMTRSEERLRVGTESQETGRARLRKYVVTENVTRTVPVTHEEVRVEREPITDANRDEA 212 Query: 118 IRGAEIKEAHIEVAL 74 + G +I EA EV L Sbjct: 213 LAGPDISEAEHEVTL 227 >ref|WP_020500216.1| hypothetical protein [Sciscionella marina] Length = 273 Score = 66.6 bits (161), Expect = 3e-09 Identities = 37/75 (49%), Positives = 47/75 (62%), Gaps = 3/75 (4%) Frame = -1 Query: 289 DAYMTRSEERLLVGKEQVGAGVASLNKYVTSEHVHTAVPITREHVVIEREPITAAD---G 119 D MTRSEERL VG EQ G A L K++ +E+V VP++ E VV+EREPIT A+ Sbjct: 136 DDAMTRSEERLYVGTEQQETGRARLRKHIVTENVTKTVPVSHEEVVVEREPITEANRGQA 195 Query: 118 IRGAEIKEAHIEVAL 74 GA++ E EV L Sbjct: 196 TSGADLSEGEHEVTL 210 >ref|WP_003802769.1| photosystem reaction center subunit H [Arthrobacter globiformis] gi|359305449|dbj|GAB14381.1| hypothetical protein ARGLB_065_00200 [Arthrobacter globiformis NBRC 12137] Length = 290 Score = 66.6 bits (161), Expect = 3e-09 Identities = 38/75 (50%), Positives = 47/75 (62%), Gaps = 3/75 (4%) Frame = -1 Query: 289 DAYMTRSEERLLVGKEQVGAGVASLNKYVTSEHVHTAVPITREHVVIEREPIT---AADG 119 D MTRSEER+ VG E+ AG A L KYV +E+ VP+ RE V +EREPIT + Sbjct: 167 DDAMTRSEERVSVGTERQAAGRARLRKYVVTENETRTVPVQREEVRLEREPITEENRGEA 226 Query: 118 IRGAEIKEAHIEVAL 74 +RG +I EA EV L Sbjct: 227 LRGQDISEAEHEVVL 241 >ref|WP_007443199.1| hypothetical protein, partial [Streptomyces coelicoflavus] gi|371548677|gb|EHN76808.1| hypothetical protein SMCF_3677, partial [Streptomyces coelicoflavus ZG0656] Length = 162 Score = 66.2 bits (160), Expect = 4e-09 Identities = 38/76 (50%), Positives = 47/76 (61%), Gaps = 3/76 (3%) Frame = -1 Query: 292 GDAYMTRSEERLLVGKEQVGAGVASLNKYVTSEHVHTAVPITREHVVIEREPITAA---D 122 GD MTRSEE++ +G E+ +G A L KYV +E V VPIT E V + REPIT A + Sbjct: 19 GDEAMTRSEEQMRIGVERHESGRARLRKYVVTEEVQQTVPITHEEVRVVREPITDANRDE 78 Query: 121 GIRGAEIKEAHIEVAL 74 + G EI EA EV L Sbjct: 79 ALAGPEISEAEHEVTL 94 >ref|WP_005160664.1| hypothetical protein [Amycolatopsis azurea] gi|449419874|gb|EMD25394.1| hypothetical protein C791_4834 [Amycolatopsis azurea DSM 43854] Length = 293 Score = 65.9 bits (159), Expect = 6e-09 Identities = 39/69 (56%), Positives = 43/69 (62%) Frame = -1 Query: 280 MTRSEERLLVGKEQVGAGVASLNKYVTSEHVHTAVPITREHVVIEREPITAADGIRGAEI 101 MTRSEERL VG EQV G L KYV +E VP++ E V IEREPIT A G + AEI Sbjct: 175 MTRSEERLNVGTEQVETGHVRLRKYVVTEEQQVTVPVSHEEVRIEREPITGASGGK-AEI 233 Query: 100 KEAHIEVAL 74 E EV L Sbjct: 234 AEDEQEVVL 242 >ref|NP_625217.1| hypothetical protein SCO0919 [Streptomyces coelicolor A3(2)] gi|499337738|ref|WP_011027446.1| photosystem reaction center subunit H [Streptomyces] gi|6580633|emb|CAB63168.1| hypothetical protein SCM10.07c [Streptomyces coelicolor A3(2)] gi|509516553|gb|EOY45866.1| hypothetical protein SLI_1149 [Streptomyces lividans 1326] Length = 319 Score = 65.5 bits (158), Expect = 8e-09 Identities = 37/76 (48%), Positives = 47/76 (61%), Gaps = 3/76 (3%) Frame = -1 Query: 292 GDAYMTRSEERLLVGKEQVGAGVASLNKYVTSEHVHTAVPITREHVVIEREPITAA---D 122 GD MTRSEE++ +G E+ +G A L KYV +E V VP+T E V + REPIT A + Sbjct: 181 GDEAMTRSEEQMHIGVERHESGRARLRKYVVTEEVQQTVPVTHEEVRVVREPITDANRDE 240 Query: 121 GIRGAEIKEAHIEVAL 74 + G EI EA EV L Sbjct: 241 ALAGPEISEAEHEVTL 256 >ref|YP_006367916.1| hypothetical protein MODMU_4039 [Modestobacter marinus] gi|504554916|ref|WP_014742018.1| photosystem reaction center subunit H [Modestobacter marinus] gi|388487879|emb|CCH89441.1| conserved protein of unknown function [Modestobacter marinus] Length = 294 Score = 65.5 bits (158), Expect = 8e-09 Identities = 39/75 (52%), Positives = 47/75 (62%), Gaps = 3/75 (4%) Frame = -1 Query: 289 DAYMTRSEERLLVGKEQVGAGVASLNKYVTSEHVHTAVPITREHVVIEREPITAA---DG 119 D MTRSEE+L VG + V AG A L KYV +E+V T VP++ E V IEREPIT A + Sbjct: 153 DNAMTRSEEQLRVGTQNVEAGRARLRKYVVTENVTTTVPVSHEEVRIEREPITDANVGNA 212 Query: 118 IRGAEIKEAHIEVAL 74 + G I E EV L Sbjct: 213 LDGPAISEEEHEVVL 227 >ref|WP_003977940.1| photosystem reaction center subunit H [Streptomyces lividans] gi|289703608|gb|EFD71037.1| conserved hypothetical protein [Streptomyces lividans TK24] Length = 322 Score = 65.5 bits (158), Expect = 8e-09 Identities = 37/76 (48%), Positives = 47/76 (61%), Gaps = 3/76 (3%) Frame = -1 Query: 292 GDAYMTRSEERLLVGKEQVGAGVASLNKYVTSEHVHTAVPITREHVVIEREPITAA---D 122 GD MTRSEE++ +G E+ +G A L KYV +E V VP+T E V + REPIT A + Sbjct: 184 GDEAMTRSEEQMHIGVERHESGRARLRKYVVTEEVQQTVPVTHEEVRVVREPITDANRDE 243 Query: 121 GIRGAEIKEAHIEVAL 74 + G EI EA EV L Sbjct: 244 ALAGPEISEAEHEVTL 259