BLASTX nr result
ID: Mentha25_contig00041841
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00041841 (308 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU25383.1| hypothetical protein MIMGU_mgv1a003872mg [Mimulus... 70 2e-10 >gb|EYU25383.1| hypothetical protein MIMGU_mgv1a003872mg [Mimulus guttatus] Length = 558 Score = 70.5 bits (171), Expect = 2e-10 Identities = 34/52 (65%), Positives = 43/52 (82%) Frame = -3 Query: 306 NSCSPSNVENNALLGAANSNIYSFSCKGNIKLLMPKMPERKKLGFNLEQEIN 151 N+C PSN++NN +L A N+N+YSFSCKGN+ LLMPKM ERKK N++QEIN Sbjct: 510 NNC-PSNIQNNLVLKAVNNNLYSFSCKGNLTLLMPKMEERKK--HNVQQEIN 558