BLASTX nr result
ID: Mentha25_contig00041764
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00041764 (380 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EHL01248.1| hypothetical protein M7I_2791 [Glarea lozoyensis ... 78 1e-12 gb|EPQ63360.1| hypothetical protein BGT96224_612 [Blumeria grami... 73 4e-11 emb|CCU81888.1| hypothetical protein BGHDH14_bgh06849 [Blumeria ... 69 9e-10 gb|EON96885.1| hypothetical protein UCRPA7_7689 [Togninia minima... 62 8e-08 ref|XP_007296479.1| hypothetical protein MBM_08590 [Marssonina b... 62 1e-07 gb|EGY22988.1| hypothetical protein VDAG_04426 [Verticillium dah... 56 5e-06 ref|XP_003005277.1| conserved hypothetical protein [Verticillium... 56 5e-06 >gb|EHL01248.1| hypothetical protein M7I_2791 [Glarea lozoyensis 74030] Length = 212 Score = 77.8 bits (190), Expect = 1e-12 Identities = 42/90 (46%), Positives = 53/90 (58%) Frame = -2 Query: 379 EEPETFHFLAAHNQVPLKSEYKPALKVLSRQPVPLMIEQIDPVTGVVQLKLGXXXXXXXX 200 EEPETFHFLAA + VPLKSE+KPALKVLSR+P P I++IDP+TG+ ++ L Sbjct: 58 EEPETFHFLAARDTVPLKSEFKPALKVLSRKPTPKRIQKIDPITGLSKMSLEDDDDEVVQ 117 Query: 199 XXKTSPXXXXXXXXXXXXXXXXRYDLARAR 110 + +P RYD RAR Sbjct: 118 TTQPTPEELRFKAQREREEKQKRYDEVRAR 147 >gb|EPQ63360.1| hypothetical protein BGT96224_612 [Blumeria graminis f. sp. tritici 96224] Length = 258 Score = 73.2 bits (178), Expect = 4e-11 Identities = 34/51 (66%), Positives = 42/51 (82%) Frame = -2 Query: 379 EEPETFHFLAAHNQVPLKSEYKPALKVLSRQPVPLMIEQIDPVTGVVQLKL 227 EE +TFH+LAA + VPLKSE+KPALKVLSR P P MIE++DP TG+ +L L Sbjct: 55 EELKTFHYLAARDNVPLKSEFKPALKVLSRNPAPRMIERLDPATGISKLVL 105 >emb|CCU81888.1| hypothetical protein BGHDH14_bgh06849 [Blumeria graminis f. sp. hordei DH14] Length = 255 Score = 68.6 bits (166), Expect = 9e-10 Identities = 31/51 (60%), Positives = 40/51 (78%) Frame = -2 Query: 379 EEPETFHFLAAHNQVPLKSEYKPALKVLSRQPVPLMIEQIDPVTGVVQLKL 227 E+ +TFH+LAA + VPLK E+KPALKVLSR P P M+E++DP TG+ L L Sbjct: 55 EDLKTFHYLAARDNVPLKCEFKPALKVLSRNPAPRMVERLDPATGLSSLVL 105 >gb|EON96885.1| hypothetical protein UCRPA7_7689 [Togninia minima UCRPA7] Length = 154 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/51 (52%), Positives = 38/51 (74%) Frame = -2 Query: 379 EEPETFHFLAAHNQVPLKSEYKPALKVLSRQPVPLMIEQIDPVTGVVQLKL 227 + PE FH+++ N VPL + +KPA+KVLSR+P P MI + DPVTG+ QL + Sbjct: 58 DAPEEFHYVSTSNNVPLATTFKPAMKVLSRKPAPRMIAKRDPVTGLEQLTI 108 >ref|XP_007296479.1| hypothetical protein MBM_08590 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] gi|406860087|gb|EKD13147.1| hypothetical protein MBM_08590 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] Length = 226 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/51 (52%), Positives = 39/51 (76%) Frame = -2 Query: 379 EEPETFHFLAAHNQVPLKSEYKPALKVLSRQPVPLMIEQIDPVTGVVQLKL 227 +EPET +FL+ VPL E+KPALK+LSR+P P M+++IDP+TG+ + L Sbjct: 65 QEPETPYFLSTRAPVPLTQEFKPALKLLSRKPTPNMVQKIDPLTGLATMTL 115 >gb|EGY22988.1| hypothetical protein VDAG_04426 [Verticillium dahliae VdLs.17] Length = 176 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/44 (54%), Positives = 33/44 (75%) Frame = -2 Query: 370 ETFHFLAAHNQVPLKSEYKPALKVLSRQPVPLMIEQIDPVTGVV 239 ETFHF+ A + VPL S +KP +KVLSR+P P + ++DPVTG + Sbjct: 61 ETFHFVEATSNVPLASTFKPQVKVLSRKPPPTVARRVDPVTGAI 104 >ref|XP_003005277.1| conserved hypothetical protein [Verticillium alfalfae VaMs.102] gi|261356346|gb|EEY18774.1| conserved hypothetical protein [Verticillium alfalfae VaMs.102] Length = 293 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/44 (54%), Positives = 33/44 (75%) Frame = -2 Query: 370 ETFHFLAAHNQVPLKSEYKPALKVLSRQPVPLMIEQIDPVTGVV 239 ETFHF+ A + VPL S +KP +KVLSR+P P + ++DPVTG + Sbjct: 61 ETFHFVEATSNVPLASTFKPQVKVLSRKPPPTVARRVDPVTGAI 104