BLASTX nr result
ID: Mentha25_contig00041321
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00041321 (367 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EEH49885.1| predicted protein [Paracoccidioides brasiliensis ... 87 3e-15 gb|AAQ04634.1|AF443189_2 Trev, partial [Paracoccidioides brasili... 87 3e-15 emb|CCU77445.1| reverse transcriptase [Blumeria graminis f. sp. ... 79 9e-13 ref|XP_002484649.1| conserved hypothetical protein [Talaromyces ... 79 9e-13 ref|XP_002488428.1| transposon I factor, putative [Talaromyces s... 79 9e-13 ref|XP_002488406.1| endonuclease/reverse transcriptase, putative... 79 9e-13 ref|XP_002488382.1| conserved hypothetical protein [Talaromyces ... 79 9e-13 ref|XP_002480375.1| transposon I factor, putative [Talaromyces s... 77 2e-12 ref|XP_002488629.1| endonuclease/reverse transcriptase, putative... 77 2e-12 ref|XP_002488544.1| conserved hypothetical protein [Talaromyces ... 77 2e-12 ref|XP_003351515.1| hypothetical protein SMAC_00056 [Sordaria ma... 77 2e-12 ref|XP_003349852.1| hypothetical protein SMAC_00741 [Sordaria ma... 77 2e-12 ref|XP_002488491.1| conserved hypothetical protein [Talaromyces ... 77 2e-12 ref|XP_002488786.1| polymerase, putative [Talaromyces stipitatus... 77 2e-12 emb|CDM26226.1| Probable transposable element [Penicillium roque... 76 4e-12 ref|XP_002486425.1| conserved hypothetical protein [Talaromyces ... 76 4e-12 ref|XP_002487805.1| conserved hypothetical protein [Talaromyces ... 76 4e-12 ref|XP_002488649.1| reverse transcriptase, putative [Talaromyces... 76 4e-12 ref|XP_002488395.1| reverse transcriptase, putative [Talaromyces... 76 4e-12 ref|XP_660265.1| hypothetical protein AN2661.2 [Aspergillus nidu... 76 4e-12 >gb|EEH49885.1| predicted protein [Paracoccidioides brasiliensis Pb18] Length = 111 Score = 86.7 bits (213), Expect = 3e-15 Identities = 44/95 (46%), Positives = 56/95 (58%), Gaps = 3/95 (3%) Frame = +2 Query: 8 LPRYSLGILLAARSGHGDFAEYHRRFHHNEAELTCDCGSEKTPDHPFHC---QMREHFTT 178 LPR +LG LLAAR+GHGDFA YH R+ H++A LTC CG +KTP+H F C + E T Sbjct: 11 LPRRNLGHLLAARTGHGDFAAYHHRWAHDDALLTCSCGRDKTPEHFFFCWKGRNIERIKT 70 Query: 179 RPRCPKRESIENDIKWALTSTDGARAFYKWCADKR 283 C + I W L++ GA F WC + R Sbjct: 71 PEAC---RGPKEAIDWLLSTVRGATTFSTWCTNTR 102 >gb|AAQ04634.1|AF443189_2 Trev, partial [Paracoccidioides brasiliensis] Length = 157 Score = 86.7 bits (213), Expect = 3e-15 Identities = 44/95 (46%), Positives = 56/95 (58%), Gaps = 3/95 (3%) Frame = +2 Query: 8 LPRYSLGILLAARSGHGDFAEYHRRFHHNEAELTCDCGSEKTPDHPFHC---QMREHFTT 178 LPR +LG LLAAR+GHGDFA YH R+ H++A LTC CG +KTP+H F C + E T Sbjct: 57 LPRRNLGHLLAARTGHGDFAAYHHRWAHDDALLTCSCGRDKTPEHFFFCWKGRNIERIKT 116 Query: 179 RPRCPKRESIENDIKWALTSTDGARAFYKWCADKR 283 C + I W L++ GA F WC + R Sbjct: 117 PEAC---RGPKEAIDWLLSTVRGATTFSTWCTNTR 148 >emb|CCU77445.1| reverse transcriptase [Blumeria graminis f. sp. hordei DH14] Length = 274 Score = 78.6 bits (192), Expect = 9e-13 Identities = 41/89 (46%), Positives = 54/89 (60%), Gaps = 3/89 (3%) Frame = +2 Query: 8 LPRYSLGILLAARSGHGDFAEYHRRFHHNEAELTCDCGSEKTPDHPFHCQM---REHFTT 178 L R +L L+AARSGHGD A+YHR F H +A +TC CG +K+PDH F+C + R Sbjct: 191 LNRRALRALIAARSGHGDLAQYHRCFAHEDALMTCSCGEKKSPDHFFYCSIGRNRARLCG 250 Query: 179 RPRCPKRESIENDIKWALTSTDGARAFYK 265 PR P + I+W L + +GA AF K Sbjct: 251 GPRHP-----HSGIRWILGTPEGALAFGK 274 >ref|XP_002484649.1| conserved hypothetical protein [Talaromyces stipitatus ATCC 10500] gi|218715274|gb|EED14696.1| conserved hypothetical protein [Talaromyces stipitatus ATCC 10500] Length = 435 Score = 78.6 bits (192), Expect = 9e-13 Identities = 41/92 (44%), Positives = 54/92 (58%) Frame = +2 Query: 8 LPRYSLGILLAARSGHGDFAEYHRRFHHNEAELTCDCGSEKTPDHPFHCQMREHFTTRPR 187 LPR+ LG +LAAR+ HGDFA+YH RF+H +A LTC CG+ K+P H CQ+ + PR Sbjct: 334 LPRHILGRILAARTKHGDFADYHERFNHTDAHLTCRCGARKSPIHFIFCQIAKR--KAPR 391 Query: 188 CPKRESIENDIKWALTSTDGARAFYKWCADKR 283 P S I + L + GA KW + R Sbjct: 392 FPGHPS--EVIPFLLGTPKGATKLAKWLTETR 421 >ref|XP_002488428.1| transposon I factor, putative [Talaromyces stipitatus ATCC 10500] gi|218712246|gb|EED11672.1| transposon I factor, putative [Talaromyces stipitatus ATCC 10500] Length = 897 Score = 78.6 bits (192), Expect = 9e-13 Identities = 39/92 (42%), Positives = 53/92 (57%) Frame = +2 Query: 8 LPRYSLGILLAARSGHGDFAEYHRRFHHNEAELTCDCGSEKTPDHPFHCQMREHFTTRPR 187 L R LG ++AAR+GHGDFA+YH RF+H++A L C CG+ K P H F C + + RP Sbjct: 796 LNRLDLGHIIAARTGHGDFADYHERFNHDDAHLLCRCGARKAPLHFFFCYIAKRRAPRPP 855 Query: 188 CPKRESIENDIKWALTSTDGARAFYKWCADKR 283 P E I + L + GA+ W A+ R Sbjct: 856 GPPSEV----ISFLLGTAKGAQKLATWLAETR 883 >ref|XP_002488406.1| endonuclease/reverse transcriptase, putative [Talaromyces stipitatus ATCC 10500] gi|218712224|gb|EED11650.1| endonuclease/reverse transcriptase, putative [Talaromyces stipitatus ATCC 10500] Length = 1732 Score = 78.6 bits (192), Expect = 9e-13 Identities = 39/92 (42%), Positives = 53/92 (57%) Frame = +2 Query: 8 LPRYSLGILLAARSGHGDFAEYHRRFHHNEAELTCDCGSEKTPDHPFHCQMREHFTTRPR 187 L R LG ++AAR+GHGDFA+YH RF+H++A L C CG+ K P H F C + + RP Sbjct: 1643 LNRLDLGHIIAARTGHGDFADYHERFNHDDAHLLCRCGARKAPLHFFFCYIAKRRAPRPP 1702 Query: 188 CPKRESIENDIKWALTSTDGARAFYKWCADKR 283 P E I + L + GA+ W A+ R Sbjct: 1703 GPPSEV----ISFLLGTAKGAQKLATWLAETR 1730 >ref|XP_002488382.1| conserved hypothetical protein [Talaromyces stipitatus ATCC 10500] gi|218712200|gb|EED11626.1| conserved hypothetical protein [Talaromyces stipitatus ATCC 10500] Length = 664 Score = 78.6 bits (192), Expect = 9e-13 Identities = 39/92 (42%), Positives = 53/92 (57%) Frame = +2 Query: 8 LPRYSLGILLAARSGHGDFAEYHRRFHHNEAELTCDCGSEKTPDHPFHCQMREHFTTRPR 187 L R LG ++AAR+GHGDFA+YH RF+H++A L C CG+ K P H F C + + RP Sbjct: 563 LNRLDLGHIIAARTGHGDFADYHERFNHDDAHLLCRCGARKAPLHFFFCYIAKRRAPRPP 622 Query: 188 CPKRESIENDIKWALTSTDGARAFYKWCADKR 283 P E I + L + GA+ W A+ R Sbjct: 623 GPPSEV----ISFLLGTAKGAQKLATWLAETR 650 >ref|XP_002480375.1| transposon I factor, putative [Talaromyces stipitatus ATCC 10500] gi|218720522|gb|EED19941.1| transposon I factor, putative [Talaromyces stipitatus ATCC 10500] Length = 728 Score = 77.4 bits (189), Expect = 2e-12 Identities = 39/94 (41%), Positives = 53/94 (56%) Frame = +2 Query: 8 LPRYSLGILLAARSGHGDFAEYHRRFHHNEAELTCDCGSEKTPDHPFHCQMREHFTTRPR 187 L R LG ++AAR+GHGDFA+YH RF+H++A L C CG+ K P H F C + + RP Sbjct: 627 LNRLDLGHVIAARTGHGDFADYHERFNHDDAYLLCRCGARKAPLHFFFCHIAKRRAPRPP 686 Query: 188 CPKRESIENDIKWALTSTDGARAFYKWCADKRPY 289 P E I + L + GA+ W A+ Y Sbjct: 687 GPPSEV----ISFLLGTAKGAQKLASWLAETHFY 716 >ref|XP_002488629.1| endonuclease/reverse transcriptase, putative [Talaromyces stipitatus ATCC 10500] gi|218712447|gb|EED11873.1| endonuclease/reverse transcriptase, putative [Talaromyces stipitatus ATCC 10500] Length = 1744 Score = 77.4 bits (189), Expect = 2e-12 Identities = 39/94 (41%), Positives = 53/94 (56%) Frame = +2 Query: 8 LPRYSLGILLAARSGHGDFAEYHRRFHHNEAELTCDCGSEKTPDHPFHCQMREHFTTRPR 187 L R LG ++AAR+GHGDFA+YH RF+H++A L C CG+ K P H F C + + RP Sbjct: 1643 LNRLDLGHVIAARTGHGDFADYHERFNHDDAYLLCRCGARKAPLHFFFCHIAKRRAPRPP 1702 Query: 188 CPKRESIENDIKWALTSTDGARAFYKWCADKRPY 289 P E I + L + GA+ W A+ Y Sbjct: 1703 GPPSEV----ISFLLGTAKGAQKLASWLAETHFY 1732 >ref|XP_002488544.1| conserved hypothetical protein [Talaromyces stipitatus ATCC 10500] gi|218712362|gb|EED11788.1| conserved hypothetical protein [Talaromyces stipitatus ATCC 10500] Length = 453 Score = 77.4 bits (189), Expect = 2e-12 Identities = 39/94 (41%), Positives = 53/94 (56%) Frame = +2 Query: 8 LPRYSLGILLAARSGHGDFAEYHRRFHHNEAELTCDCGSEKTPDHPFHCQMREHFTTRPR 187 L R LG ++AAR+GHGDFA+YH RF+H++A L C CG+ K P H F C + + RP Sbjct: 352 LNRLDLGHVIAARTGHGDFADYHERFNHDDAYLLCRCGARKAPLHFFFCHIAKRRAPRPP 411 Query: 188 CPKRESIENDIKWALTSTDGARAFYKWCADKRPY 289 P E I + L + GA+ W A+ Y Sbjct: 412 GPPSEV----ISFLLGTAKGAQKLASWLAETHFY 441 >ref|XP_003351515.1| hypothetical protein SMAC_00056 [Sordaria macrospora k-hell] gi|380095794|emb|CCC05840.1| unnamed protein product [Sordaria macrospora k-hell] Length = 297 Score = 77.0 bits (188), Expect = 2e-12 Identities = 33/48 (68%), Positives = 38/48 (79%) Frame = +2 Query: 14 RYSLGILLAARSGHGDFAEYHRRFHHNEAELTCDCGSEKTPDHPFHCQ 157 R+SL LLAARSGHGDF +YH RF H +A LTC CG+ KTP HPFHC+ Sbjct: 134 RWSLHYLLAARSGHGDFKDYHERFEHEDALLTCYCGTWKTPFHPFHCR 181 >ref|XP_003349852.1| hypothetical protein SMAC_00741 [Sordaria macrospora k-hell] gi|380095241|emb|CCC06714.1| unnamed protein product [Sordaria macrospora k-hell] Length = 657 Score = 77.0 bits (188), Expect = 2e-12 Identities = 35/50 (70%), Positives = 38/50 (76%) Frame = +2 Query: 8 LPRYSLGILLAARSGHGDFAEYHRRFHHNEAELTCDCGSEKTPDHPFHCQ 157 L R SL LLAARSGHGDF +YH RF H +A LTC CGS KTP HPFHC+ Sbjct: 488 LDRRSLHHLLAARSGHGDFKDYHERFEHEDALLTCYCGSWKTPFHPFHCR 537 >ref|XP_002488491.1| conserved hypothetical protein [Talaromyces stipitatus ATCC 10500] gi|218712309|gb|EED11735.1| conserved hypothetical protein [Talaromyces stipitatus ATCC 10500] Length = 360 Score = 77.0 bits (188), Expect = 2e-12 Identities = 38/90 (42%), Positives = 52/90 (57%) Frame = +2 Query: 8 LPRYSLGILLAARSGHGDFAEYHRRFHHNEAELTCDCGSEKTPDHPFHCQMREHFTTRPR 187 L R LG ++AAR+GHGDFA+YH RF+H++A L C CG+ K P H F C + + RP Sbjct: 156 LNRLDLGHIIAARTGHGDFADYHERFNHDDAHLLCRCGARKAPLHFFFCYIAKRRAPRPP 215 Query: 188 CPKRESIENDIKWALTSTDGARAFYKWCAD 277 P E I + L + GA+ W A+ Sbjct: 216 GPPSEV----ISFLLGTAKGAQKLATWLAE 241 >ref|XP_002488786.1| polymerase, putative [Talaromyces stipitatus ATCC 10500] gi|218712042|gb|EED11470.1| polymerase, putative [Talaromyces stipitatus ATCC 10500] Length = 1503 Score = 77.0 bits (188), Expect = 2e-12 Identities = 40/92 (43%), Positives = 54/92 (58%) Frame = +2 Query: 8 LPRYSLGILLAARSGHGDFAEYHRRFHHNEAELTCDCGSEKTPDHPFHCQMREHFTTRPR 187 LPR+ LG +LAAR+ HGDFA+YH F+H +A LTC CG+ K+P H CQ+ + PR Sbjct: 1402 LPRHILGRILAARTKHGDFADYHEWFNHTDAHLTCRCGARKSPIHFIFCQIAKR--KAPR 1459 Query: 188 CPKRESIENDIKWALTSTDGARAFYKWCADKR 283 P+ S I + L + GA KW + R Sbjct: 1460 FPRHPS--EVIPFLLGTPKGATKLAKWLTETR 1489 >emb|CDM26226.1| Probable transposable element [Penicillium roqueforti] Length = 135 Score = 76.3 bits (186), Expect = 4e-12 Identities = 41/85 (48%), Positives = 50/85 (58%), Gaps = 1/85 (1%) Frame = +2 Query: 8 LPRYSLGILLAARSGHGDFAEYHRRFHHNEAELTCDCGSEKTPDHPFHC-QMREHFTTRP 184 LPR LG LLAAR+GHGDF YH RFHH ++ TC CG K+P H F C R+ + R Sbjct: 29 LPRGVLGRLLAARTGHGDFQVYHERFHHRDSPTTCSCGKPKSPVHFFFCPPARKRWKDRW 88 Query: 185 RCPKRESIENDIKWALTSTDGARAF 259 + PK S I W L++ GA F Sbjct: 89 KGPK-ASPSAMIDWILSTAAGAEEF 112 >ref|XP_002486425.1| conserved hypothetical protein [Talaromyces stipitatus ATCC 10500] gi|218714764|gb|EED14187.1| conserved hypothetical protein [Talaromyces stipitatus ATCC 10500] Length = 285 Score = 76.3 bits (186), Expect = 4e-12 Identities = 38/90 (42%), Positives = 52/90 (57%) Frame = +2 Query: 8 LPRYSLGILLAARSGHGDFAEYHRRFHHNEAELTCDCGSEKTPDHPFHCQMREHFTTRPR 187 L R LG ++AAR+GHGDFA+YH RF+H++A L C CG+ K P H F C + + RP Sbjct: 184 LNRLDLGHVIAARTGHGDFADYHERFNHDDAYLLCRCGARKAPLHFFFCHIAKRRAPRPP 243 Query: 188 CPKRESIENDIKWALTSTDGARAFYKWCAD 277 P E I + L + GA+ W A+ Sbjct: 244 GPPSEV----ISFLLGTAKGAQKLATWLAE 269 >ref|XP_002487805.1| conserved hypothetical protein [Talaromyces stipitatus ATCC 10500] gi|218712726|gb|EED12151.1| conserved hypothetical protein [Talaromyces stipitatus ATCC 10500] Length = 333 Score = 76.3 bits (186), Expect = 4e-12 Identities = 38/90 (42%), Positives = 52/90 (57%) Frame = +2 Query: 8 LPRYSLGILLAARSGHGDFAEYHRRFHHNEAELTCDCGSEKTPDHPFHCQMREHFTTRPR 187 L R LG ++AAR+GHGDFA+YH RF+H++A L C CG+ K P H F C + + RP Sbjct: 232 LTRLDLGHMIAARTGHGDFADYHERFNHDDAHLLCRCGARKAPLHFFFCHIAKRRAPRPP 291 Query: 188 CPKRESIENDIKWALTSTDGARAFYKWCAD 277 P E I + L +T A+ W A+ Sbjct: 292 GPPSEV----IPFLLGTTKAAQKLAIWLAE 317 >ref|XP_002488649.1| reverse transcriptase, putative [Talaromyces stipitatus ATCC 10500] gi|218712467|gb|EED11893.1| reverse transcriptase, putative [Talaromyces stipitatus ATCC 10500] Length = 1747 Score = 76.3 bits (186), Expect = 4e-12 Identities = 38/92 (41%), Positives = 52/92 (56%) Frame = +2 Query: 8 LPRYSLGILLAARSGHGDFAEYHRRFHHNEAELTCDCGSEKTPDHPFHCQMREHFTTRPR 187 L R L ++AAR+GHGDFA YH RF+H++A L C CG+ K P H F C++ + RP Sbjct: 1645 LNRLDLSHIIAARTGHGDFANYHERFNHDDAHLLCRCGARKAPLHFFFCRIAKRRAPRPP 1704 Query: 188 CPKRESIENDIKWALTSTDGARAFYKWCADKR 283 P E I + L + GA+ W A+ R Sbjct: 1705 GPPTEV----ISFLLGTAKGAQKLATWLAETR 1732 >ref|XP_002488395.1| reverse transcriptase, putative [Talaromyces stipitatus ATCC 10500] gi|218712213|gb|EED11639.1| reverse transcriptase, putative [Talaromyces stipitatus ATCC 10500] Length = 669 Score = 76.3 bits (186), Expect = 4e-12 Identities = 38/90 (42%), Positives = 52/90 (57%) Frame = +2 Query: 8 LPRYSLGILLAARSGHGDFAEYHRRFHHNEAELTCDCGSEKTPDHPFHCQMREHFTTRPR 187 L R LG ++AAR+GHGDFA+YH RF+H++A L C CG+ K P H F C + + RP Sbjct: 568 LNRLDLGHVIAARTGHGDFADYHERFNHDDAYLLCRCGARKAPLHFFFCHIAKRRAPRPP 627 Query: 188 CPKRESIENDIKWALTSTDGARAFYKWCAD 277 P E I + L + GA+ W A+ Sbjct: 628 GPPSEV----ISFLLGTAKGAQKLATWLAE 653 >ref|XP_660265.1| hypothetical protein AN2661.2 [Aspergillus nidulans FGSC A4] gi|40743879|gb|EAA63063.1| hypothetical protein AN2661.2 [Aspergillus nidulans FGSC A4] gi|259486429|tpe|CBF84258.1| TPA: conserved hypothetical protein [Aspergillus nidulans FGSC A4] Length = 1538 Score = 76.3 bits (186), Expect = 4e-12 Identities = 39/85 (45%), Positives = 52/85 (61%), Gaps = 1/85 (1%) Frame = +2 Query: 8 LPRYSLGILLAARSGHGDFAEYHRRFHHNEAELTCDCGSEKTPDHPFHC-QMREHFTTRP 184 LPR+ LG L+AAR+GHGDF YH+RF+H++ +C CG KTP H F C R+ + R Sbjct: 1433 LPRWVLGRLVAARTGHGDFTAYHQRFNHSDYLESCSCGKTKTPVHFFFCPYTRKRWKDRW 1492 Query: 185 RCPKRESIENDIKWALTSTDGARAF 259 RC R+ I W L++ GA F Sbjct: 1493 RC-IRDGPSKTIDWLLSTAAGAEEF 1516